KEGG   Staphylococcus equorum: SE1039_18120Help
Entry
SE1039_18120      CDS       T04160                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
seqo  Staphylococcus equorum
Pathway
seqo00010  Glycolysis / Gluconeogenesis
seqo00053  Ascorbate and aldarate metabolism
seqo00071  Fatty acid degradation
seqo00280  Valine, leucine and isoleucine degradation
seqo00310  Lysine degradation
seqo00330  Arginine and proline metabolism
seqo00340  Histidine metabolism
seqo00380  Tryptophan metabolism
seqo00410  beta-Alanine metabolism
seqo00561  Glycerolipid metabolism
seqo00620  Pyruvate metabolism
seqo00625  Chloroalkane and chloroalkene degradation
seqo01100  Metabolic pathways
seqo01110  Biosynthesis of secondary metabolites
seqo01120  Microbial metabolism in diverse environments
seqo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:seqo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE1039_18120
   00053 Ascorbate and aldarate metabolism
    SE1039_18120
   00620 Pyruvate metabolism
    SE1039_18120
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SE1039_18120
   00561 Glycerolipid metabolism
    SE1039_18120
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SE1039_18120
   00310 Lysine degradation
    SE1039_18120
   00330 Arginine and proline metabolism
    SE1039_18120
   00340 Histidine metabolism
    SE1039_18120
   00380 Tryptophan metabolism
    SE1039_18120
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SE1039_18120
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SE1039_18120
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SE1039_18120
Enzymes [BR:seqo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SE1039_18120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALM57595
UniProt: A0A1E5THA6
LinkDB All DBs
Position
complement(1884720..1886147)
Genome map
AA seq 475 aa AA seqDB search
MRNFTKQYINGEWIESTSGETLEVINPATEEVAGTIAKGNKEDVDKAVDAAENVYLEFRH
SSIEERRTLLDKIVQEYKNRKDDLIEAITDELGAPLSVSEKVHYQMGLDHFEAARDALDN
FEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLSAAFAAGSPVVLKPSEETPFAAI
ILAEIFDKVGVPKGVFNLVNGDGQGVGNPLSEHPKVRMMSFTGSGPTGSSIMKKAAEDFK
KVSLELGGKSPYIILDDSDIDGAASAATGKVVSNTGQVCTAGTRTLVPASLKEEFLTAVK
EKFSQVKVGDPREEGTQVGPIISKKQFDQVQSYIDKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFNNVDNSMTIAQEEIFGPVMSIITYNDLDEAIKIANDTKYGLAGYVYGNDKDTLH
KVARSIEAGTVEINEAGRKSDLPFGGYKQSGIGREWGDYGIEEFLEVKSIAGYYK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcactaaacaatatattaacggagaatggatcgaaagcactagtggagaa
acactagaagttattaatccagcgacagaagaagtagcaggtacaattgcgaaaggtaat
aaagaagatgttgataaagcagtagacgctgcagaaaatgtgtatctagaatttagacac
agctcaatagaagaaagaagaacattattagataaaatagtacaagaatataaaaataga
aaagatgatcttatagaggcaattacagacgaattaggtgcgcctttatcagtatcagaa
aaagtacattatcaaatgggactagatcactttgaagcagcacgtgatgcattagataat
tttgaatttgaagaacgtcgtggtgatgatttagttgtgaaggaagcaattggtgtttct
ggcttaatcacaccttggaatttcccaacgaatcaaacttcattgaaattatctgccgct
tttgcagcaggaagtccagtcgtattaaaaccatctgaagagacaccattcgccgcaatt
attttggctgaaatttttgataaagtaggcgtgccaaaaggtgtgtttaacttagtgaat
ggtgatggacaaggtgtaggtaatccattaagtgaacatccgaaagtaagaatgatgtcg
ttcactggctctggtccaactggttcaagcattatgaaaaaagcagctgaagatttcaaa
aaagtgtcacttgaattgggcggtaaatcaccatatattattttagatgattcagatatt
gatggtgcagcaagtgcagcaactggtaaagttgttagcaatactggtcaagtttgtaca
gcaggtaccagaacattagtaccagcaagtctaaaagaagaattcttaacagctgtaaaa
gaaaaattcagtcaagttaaagtcggtgatccacgcgaagaaggcactcaagttggtcca
atcattagtaaaaaacaatttgaccaagtacaatcatatatcgataaaggtattgaagaa
ggtgcagaattattctatggtggacctggcaaacctgaaggcttagaaaaaggttacttt
gctcgcccaacaatatttaataatgttgataatagtatgacaatcgcgcaagaagaaatt
tttggcccagtgatgtcaattatcacttacaatgatttagatgaagcaattaaaattgca
aatgatactaaatatggcttagctggatatgtatacggtaatgataaagacacattacac
aaagtagcacgttcaattgaagctggtacagtagaaattaatgaagctggccgtaaatcg
gacttaccatttggtggttataaacaatctggtattggacgcgaatggggcgactacggt
atcgaagaattcctagaagttaagtccattgctggctattataaataa

DBGET integrated database retrieval system