KEGG   Streptococcus equi subsp. zooepidemicus CY: Q426_03020Help
Entry
Q426_03020        CDS       T03306                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sequ  Streptococcus equi subsp. zooepidemicus CY
Pathway
sequ00010  Glycolysis / Gluconeogenesis
sequ00020  Citrate cycle (TCA cycle)
sequ00620  Pyruvate metabolism
sequ01100  Metabolic pathways
sequ01110  Biosynthesis of secondary metabolites
sequ01120  Microbial metabolism in diverse environments
sequ01130  Biosynthesis of antibiotics
sequ01200  Carbon metabolism
Module
sequ_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sequ00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q426_03020
   00020 Citrate cycle (TCA cycle)
    Q426_03020
   00620 Pyruvate metabolism
    Q426_03020
Enzymes [BR:sequ01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Q426_03020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AIA67420
UniProt: A0A0E1DRT4
LinkDB All DBs
Position
604326..605732
Genome map
AA seq 468 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDTVSEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGETVPVTEVIGYIGAAGESVDGSASSKKATETPVPTTSSANAVTASKEAASTAPQVA
SAANAPAFGEKVRATPAARKAASEMGIELNQVPGTGPKGRIHKEDVEGFKGAQPKATPLA
RKIAADKGVDLAAVVGTGIGGKITKEDILAVLGAAAPAVEKASIAEEKPAKELPEGVEIK
KMSAMRKAISKGMTHSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLIG
LAVVKTLMKPEHEYMNASLINDANDIELHRFVNLGIAVGLDDGLVVPVVHGADKMSLSEF
VLASKDVIKKAQGGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGIGATIPTP
TVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattattatgccaaagctcggtgttgacatgcaagaaggcgagatcatc
gagtggaaaaagcaggagggtgacactgtcagcgagggtgacattcttcttgaaatcatg
tcagacaagacaaatatggagcttgaagcagaggactcaggtgtgcttctaaaaatcact
cgccaggcaggtgaaacagtccctgtcactgaggttatcggctatattggtgctgcgggt
gaatctgttgatggctctgcttcaagtaaaaaagcaactgaaaccccagtaccaacaaca
tcatcagctaatgcagtaactgcctcaaaagaagcagcttcaacagcgcctcaggtagca
tcagctgccaatgctccagctttcggagaaaaggttcgcgcaacgccagcagctcgtaaa
gcagcttcagaaatgggaattgagcttaaccaagtaccaggaacaggaccaaaaggccgt
atccacaaagaagacgttgaaggtttcaagggagctcagcctaaggcaacgccacttgct
cgtaagatagctgccgacaagggagttgaccttgcagcagtggtcggaacaggtattggt
ggcaagattaccaaggaggacattttggctgtgcttggcgcagcagcacctgctgtggaa
aaagcatctattgctgaagaaaagcctgctaaggagcttccagagggtgttgaaattaag
aagatgtctgctatgcgtaaggctatttcaaagggtatgacacattcctaccttacagca
ccaacctttacgcttaattatgacattgacatgaccgaaatgattgccttgcgtaagaag
ctgattgacccaatcatggctaaaacagggctaaaggttagctttactgatttgattggt
ttagccgttgttaagaccttgatgaagccagagcacgaatacatgaatgcgtcattgatt
aatgatgctaatgatattgagcttcatcgctttgtcaaccttggtattgctgtaggactt
gatgatgggctagttgtgccggttgttcatggtgcagataagatgagtctctcagagttt
gtccttgcttctaaggacgttatcaaaaaggctcaaggaggcaagctaaaggctgccgaa
atgtcaggctcaaccttctccatcacaaatctgggtatgtttggcaccaaaaccttcaat
ccaattatcaatcagcctaattcagctattctaggtattggggcaaccattccaacccca
acagtggtcgatggtgagattgttgcacgtccaatcatggcaatgtgtctgacaattgat
caccgcctggtggacggcatgaatggtgctaaattcatggttgatctcaaaaaattgatg
gaaaatccatttgaactgctaatctga

DBGET integrated database retrieval system