KEGG   Streptococcus equi subsp. zooepidemicus CY: Q426_03940Help
Entry
Q426_03940        CDS       T03306                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sequ  Streptococcus equi subsp. zooepidemicus CY
Pathway
sequ00240  Pyrimidine metabolism
sequ01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sequ00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Q426_03940
Enzymes [BR:sequ01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Q426_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30 ATPase_2
Motif
Other DBs
NCBI-ProteinID: AIA67570
UniProt: A0A0E1DSA6
LinkDB All DBs
Position
783274..783843
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAV
PISSDMDIFAFIAELQEKPYCVLIDECQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQYCSKKATMVLRTEHGKPVYEGAQIQIGGNETYIPVC
RKHYFHPPI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaattatattacaaatatggaacaatgaattcaggaaagaccattgaaatcttg
aaggtagcacacaattatgaagaacaggggaaacctgttgtgattatgacaagtgcgcta
gacacacgtgatggctttggcattgtttctagtcgaattggcatgcgtcgtgaggctgta
cccatttcgagtgatatggatatttttgcatttattgctgaattgcaggagaagccctat
tgcgtcttgattgacgaatgtcaatttttaagcaagcaaaatgtctatgatttagcacgt
gtggttgatgagctaaatgttccagtgatggcctttggcttaaaaaatgattttcaaaat
gaattgtttgaaggctccaaatacctgttactgttagctgataagattgatgagataaaa
accatctgtcaatattgcagcaaaaaagcaactatggtattgcgaacagaacatggtaag
cccgtttatgagggagcacagattcaaattggtggcaatgagacctatattccagtttgt
cgcaagcattattttcacccaccaatctaa

DBGET integrated database retrieval system