KEGG   Streptococcus equi subsp. zooepidemicus CY: Q426_06050Help
Entry
Q426_06050        CDS       T03306                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sequ  Streptococcus equi subsp. zooepidemicus CY
Brite
Enzymes [BR:sequ01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Q426_06050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIA67869
UniProt: A0A0E1DY97
LinkDB All DBs
Position
complement(1216029..1216634)
Genome map
AA seq 201 aa AA seqDB search
MTITLPDLPYAYDALEPYFDTETMTLHHDKHHATYVANTNAALEKYPELGENLEELLADV
SSIPADIRQAVINNGGGHLNHALFWELLSPEKQEVSADVAAAIDDAFGSFAAFKEQFTAA
ATGRFGSGWAWLVVNKAGQLEITSTANQDTPISEGKQPILALDVWEHAYYLNYRNVRPNY
IKAFFEIINWKKVSELYQAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgactattacattaccagatcttccgtacgcatatgatgcccttgagccttattttgac
acagagacaatgacgcttcatcatgataagcaccatgccacctatgtggccaacacaaac
gctgccttggaaaaatacccagagctaggagaaaatttagaggaattattagcagatgta
agcagcattcctgctgacattcgtcaggctgtgattaataatggcggtggccatttgaac
catgcgcttttctgggagctgctttctccagaaaagcaagaggtttctgctgatgtcgca
gcagctattgatgacgcttttggttcctttgctgcctttaaagagcaattcacagcagca
gctacgggtcgttttggctcaggttgggcctggctggttgtgaataaggctggtcagctt
gaaattacatcaactgctaatcaggacacaccaatctcagagggcaagcagcctatttta
gcacttgatgtttgggagcatgcttattacctcaattaccgcaatgttcgtccaaattat
atcaaggccttctttgaaatcattaattggaaaaaggtctcagagctttaccaagctgca
aaataa

DBGET integrated database retrieval system