KEGG   Streptococcus equi subsp. zooepidemicus CY: Q426_06115Help
Entry
Q426_06115        CDS       T03306                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sequ  Streptococcus equi subsp. zooepidemicus CY
Pathway
sequ00473  D-Alanine metabolism
sequ00550  Peptidoglycan biosynthesis
sequ01100  Metabolic pathways
sequ01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sequ00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Q426_06115
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Q426_06115
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Q426_06115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sequ01011]
    Q426_06115
Enzymes [BR:sequ01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Q426_06115
Peptidoglycan biosynthesis and degradation proteins [BR:sequ01011]
 Precursor biosynthesis
  Amino acid ligase
   Q426_06115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AIA67879
UniProt: A0A0E1DYA6
LinkDB All DBs
Position
complement(1231543..1232589)
Genome map
AA seq 348 aa AA seqDB search
MSKQTLILLYGGRSAEREVSVLSAESVMRAIDYTKFFVKTYFISQTGQFIKTQEFSSQPA
ATERLMTNDTIRLEQQIRPSDVYEEGAVVFPVLHGPMGEDGSIQGFLEVLKMPYVGTNIL
SSSVAMDKIATKRVLESAGIPQVAYTVYIEGQDLDRCLAETEAALSYPIFVKPANMGSSV
GISKAESEEELRAAILLALKYDSRILIEQGVSAREIEVGLLGNTDVKSTLPGEVVKNVDF
YDYRAKYIDNEITMTIPAAIDESAMTSMRIYAETAFKAIGACGLSRCDFFLGQDGQIYLN
ELNTMPGFTQWSMYPLLWEHMGLSYAELIEELVRLAQEMFEKREGHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaaccttaattttattatacggagggcgttcggcagagcgtgaagtatca
gtgctttcagctgagagcgtgatgagagcaattgattacaccaaattttttgttaaaacc
tattttatcagccagacaggtcaatttatcaaaacacaggaattctccagccagccggct
gcaacagaaaggctgatgactaatgacactattaggctagaacagcagataaggcctagt
gatgtctacgaggagggggctgttgtttttccagtcctgcatggccctatgggagaggac
ggctctattcaaggctttttagaggtgttaaaaatgccttatgtggggactaatatcctc
tcatcaagtgttgctatggataagattgccaccaaaagagttctagagtcagctggtatc
ccacaggttgcttataccgtttatattgagggacaggatttagataggtgtctggcagag
actgaggcagccttaagctaccctatttttgttaagccggctaatatgggatcatctgtt
ggtatttctaaggcagagtcagaggaggagctgcgtgcggctattctgctagctctgaaa
tatgatagtcgtatcctcattgagcagggagtttctgctagagagattgaggttgggctg
cttggtaataccgatgtcaaatcaacccttccaggagaggtggtcaagaatgttgacttt
tatgactatcgagccaaatatattgataacgagatcacaatgactattccggcggctatt
gacgaatcagctatgacaagcatgcgtatctacgcagagacagcctttaaggctattggt
gcttgtggcctgtcgcgttgtgatttcttccttggtcaggacggtcagatctacctcaat
gaattaaataccatgcctggctttacgcagtggtccatgtatcccttgctctgggagcat
atgggactgagctatgctgagcttattgaggagctagtcagattagcacaggaaatgttt
gaaaagcgtgaagggcatttaatataa

DBGET integrated database retrieval system