KEGG   Streptococcus equi subsp. zooepidemicus CY: Q426_07365Help
Entry
Q426_07365        CDS       T03306                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sequ  Streptococcus equi subsp. zooepidemicus CY
Pathway
sequ00220  Arginine biosynthesis
sequ00250  Alanine, aspartate and glutamate metabolism
sequ00290  Valine, leucine and isoleucine biosynthesis
sequ01100  Metabolic pathways
sequ01110  Biosynthesis of secondary metabolites
sequ01130  Biosynthesis of antibiotics
sequ01210  2-Oxocarboxylic acid metabolism
sequ01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sequ00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Q426_07365
   00290 Valine, leucine and isoleucine biosynthesis
    Q426_07365
   00220 Arginine biosynthesis
    Q426_07365
Enzymes [BR:sequ01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Q426_07365
    2.6.1.66  valine---pyruvate transaminase
     Q426_07365
Amino acid related enzymes [BR:sequ01007]
 Aminotransferase (transaminase)
  Class I
   Q426_07365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIA68048
UniProt: A0A0E1DZU7
LinkDB All DBs
Position
complement(1478486..1479700)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAAFGFEAPDEVIRDLIL
NARSSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIDDIYLGNGVSELISMSLQALLDNGD
EVLVPMPDYPLWTACVSLGGGHAVHYLCDEEAEWYPDIADIKAKITERTKAIVIINPNNP
TGALYPREVLEEIVAIAREHQLIIFADEIYDRLVMDGGEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKRHVRGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDELL
LPGGRIFEQRNFIYQAINAIPGLSAVKPKAGLYLFPKIDRSMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKEPDHFRVVYLPTVEELTDVQEKITRVLKQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataattgaaaaatcatcaaaattagaacacgtagcctacgatattcgaggtcca
gtcctggacgaggctaatcgtatgatagctaatggtgaaaagatccttcgattaaataca
ggtaacccagcagcctttggctttgaggctccagatgaggttattcgtgatttgatcctc
aatgctcgctccagcgagggctattctgatagtaaggggattttttcagcccgtaaggcc
atcatgcaatattgtcagctaaagggctttcctgatgttgacattgatgatatttatttg
ggaaatggtgtctcagagctgatttcgatgtctcttcaagccttgctcgataatggtgat
gaggtgctggtgccaatgcctgactatcccctttggacagcctgtgtcagcctaggtggt
gggcatgcggtgcattacctgtgtgatgaagaggctgaatggtatcctgatattgctgac
ataaaagccaagatcactgagcgcacaaaggctatcgtcattatcaatcccaataaccca
acaggtgctctctaccctcgagaggtcttagaggagattgttgcaattgccagagagcat
cagctcatcatttttgcagatgagatttatgatcgtttggtcatggacggtggggagcat
atcgcaattgccagccttgcacctgatgttttttgcgtgtcaatgaatgggctgtcaaaa
tcacaccgtattgccggctttcgagtgggctggatggtcttgtcaggtcctaaaagacat
gtcagaggttacattgaaggcttgaacatgctggcaaacatgcgcttgtgctccaatgtc
ttggcgcagcaggtggtgcagacctccttaggaggacgtcagtctgttgatgagctcttg
cttccgggtggtcgcatctttgagcaacgtaacttcatttaccaggcgatcaatgccatt
ccaggcctatcagctgtaaagcctaaggcaggcctctatttgtttccgaaaattgatcga
agcatgtaccgcattgatgatgatgaggaatttgtcctacagcttttgaagcaagaaaag
gtcatgctggtacatgggcgtggcttcaactggaaggagcctgatcattttcgcgtggtc
tatctgccaacagtggaagagctaactgacgtgcaagaaaagatcacgcgtgttctcaag
caatacaagcgctaa

DBGET integrated database retrieval system