KEGG   Staphylococcus epidermidis RP62A (MRSE): SERP0059Help
Entry
SERP0059          CDS       T00229                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ser  Staphylococcus epidermidis RP62A (MRSE)
Brite
KEGG Orthology (KO) [BR:ser00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SERP0059 (ahpF)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SERP0059 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like Thi4 AlaDh_PNT_C NAD_binding_8 FAD_binding_3 DAO K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AAW53450
UniProt: Q5HRY2
LinkDB All DBs
Position
complement(46330..47853)
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLQQLLELMEGDVEFVASLGSDDKSNELKELLNEMAEMSAHITITEKSLKRT
PSFSVNRPGEETGITFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKGLEGPFHFE
TFVSLTCQKCPDVVQALNLMSVINPNITHTMIDGAVFREESENIMAVPAVFLDGQEFGNG
RMTVQDILTKLGSTQDASEFNDKDPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLAEHIAQYDIDTMTGIRATNIEKTDSAIRVTLEND
AVLESKTVIISTGASWRKLNIPGEDRLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVKHVTLFEYASELKADSVLQERLRSLPNVDIKTSAKTTEVIGDDYVTGISYED
MTTGESQVVNLDGIFVQIGLVPNTSWLQNAVELNERGEVMINRDNATNVPGIFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaagcaacaattacaacaattacttgagcttatggaaggcgac
gttgaattcgttgccagcctaggctctgatgataaatcaaacgaactcaaagaattatta
aatgagatggctgagatgtcagcacacataacaataactgaaaaatctttaaaacgtaca
ccaagtttttcagttaatcgccctggtgaagaaacaggtattacctttgctggcatacct
ttaggccatgaattcaactctttagtattagctatactacaagtgagtggtcgcgcacct
aaagaaaagcaatccattattgatcaaattaaagggctcgaaggtccatttcatttcgaa
acctttgtaagtcttacttgtcaaaagtgtcctgacgtcgttcaagcattaaacctaatg
agtgttattaatcctaacattactcatactatgattgatggcgctgttttccgtgaagaa
tctgaaaacattatggcagttcctgccgtcttcttagatggtcaagaatttggtaatgga
cgcatgacagttcaagatattttaactaaattaggaagcacgcaagatgcctctgaattc
aacgataaagatccttatgacgtgttaatcgttggtggcggacctgcaagtggtagtgct
gcaatttatacagcacgtaaagggctacgtacaggtattgtcgctgatcgaattggtggt
caagttaatgatactgctggtatcgagaacttcatcactgttaaagaaacgacaggttca
gagttctcatcaaatcttgcagaacatattgcacaatatgatattgatacaatgactggt
attcgtgctacaaatatcgaaaaaacagattcagctattcgcgtaactttagaaaatgat
gctgttttagaaagtaaaactgtcatcatttccacaggtgcaagttggcgtaaactaaac
atcccaggcgaagaccgtctaatcaataaaggcgtggctttctgccctcactgtgacgga
cctttatttgaaaataaagatgttgctgtcatcggtggtggtaactctggtgtagaagca
gctattgatttagccggcatcgttaaacacgtaacattatttgaatacgcttctgaatta
aaagctgatagcgtattacaagaacgtttacgctcactacctaatgttgatattaaaacg
agtgctaaaacaacagaagtaattggtgacgattacgttacaggtattagctatgaagat
atgactaccggagagtcacaagtagttaatttagatggaatatttgtacagattggatta
gttcctaatacatcttggttgcaaaatgctgtcgaattaaatgaacgtggcgaggttatg
attaatcgcgataacgcaacaaacgttcctggtatctttgcagctggtgacgttaccgat
caaaaaaataagcaaattattatttctatgggtgctggtgctaatgccgcacttaatgca
ttcgattatataattagaaattaa

DBGET integrated database retrieval system