KEGG   Staphylococcus epidermidis RP62A: SERP0986Help
Entry
SERP0986          CDS       T00229                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00020  Citrate cycle (TCA cycle)
ser00310  Lysine degradation
ser00380  Tryptophan metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
ser01200  Carbon metabolism
Module
ser_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ser_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ser00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SERP0986 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    SERP0986 (sucA)
   00380 Tryptophan metabolism
    SERP0986 (sucA)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SERP0986 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AAW54333
UniProt: Q5HPC6
LinkDB All DBs
Position
complement(1002485..1005289)
Genome map
AA seq 934 aa AA seqDB search
MTKNKKEFTEAPVNFGANLGLMLDLYDDYLQDPSSVPEDLQVLFSTIKTGEAHIEAKPTT
DGGGSQAGDSTIKRVMRLIDNIRQYGHLKADIYPVNPPERQNVPKLEIEDFDLDKETLEK
ISSGIVSEHFKDIYDNAYDAIVRMERRYKGPIAFEYTHINNNKERVWLKRRIETPYKASL
NDNQKKELFKKLAHVEGFEKYLHKNFVGAKRFSIEGVDTLVPMLQHTITLAGNEGIKNIQ
IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLELTSGWTSDVKYHLGGVK
TTNSYGIEQRISLANNPSHLEIVAPVVAGKTRAAQDNTHQVGGPSTDFHKAMPIIIHGDA
AYPGQGINFETMNLGSLKGYSTGGSLHIITNNRIGFTTEPFDGRSTTYSSDVAKGYDVPI
LHVNADDVEATIEAIEIAMEFRKEFHKDVVIDLVGYRRYGHNEMDEPSITNPVPYQNIRK
HDSVEILYGKKLVDEGIISEDEMNEVIDSVQKEMRTAHDKIDKNDKMNNPDMEKPESLQL
PLQSDTKDFSFDHLKEINDAMLDYPKDFHVLKKLNKVLEKRREPFEKEGGLVDWAQAEQL
AFATILQDGTSIRLTGQDSERGTFSHRHAVLHDEENGNTFTPLHHVPQQQATFDIHNSPL
SEAAVVGFEYGYNVENKGNFNIWEAQYGDFSNMSQMMFDNFLSSSRAKWGERSGLTLFLP
HAFEGQGPEHSSARLERFLQLAAENNSTVVNLSSASNYFHLLRAQAASLDTLEMRPLIVM
SPKSLLRNKTVAKPIDEFTSGGFKPIITEDIDEQKVKKVILASGKMYIDLKEYLAKNPND
SILLIAVERLYPFPEEEIKEVLKSLPHLENVSWVQEEPKNQGAWLFVYPYLKALVANKYD
LTYHGRIQRAAPAEGDGEIHKLVQTKIIESSINN
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaacaagaaagaatttacagaggctcctgtaaacttcggtgcaaatcttggc
cttatgctagatttgtatgatgattatctacaagatccatcatccgtacctgaagattta
caagtcttgttcagtacaattaaaacaggtgaagctcatatcgaagctaaacctaccact
gatgggggtggttcacaagcgggagatagcacaattaaacgtgttatgcgcttaatcgat
aatattcgtcaatacggacatttaaaagcagatatttatccagtaaatcctccagagcgt
caaaatgttcctaaattagaaatcgaagattttgatttagataaagaaactttggaaaaa
atatcatctggaattgtctctgaacattttaaagacatttatgacaatgcctatgatgca
attgttcgtatggaaagacgttacaaaggaccgatagcttttgaatacactcacattaat
aataataaagaacgtgtgtggttaaaaagaagaattgaaacgccttataaagcaagttta
aacgataatcaaaaaaaagaacttttcaaaaaactcgcacacgtagaaggttttgaaaaa
tatttgcacaaaaattttgttggggctaaacgtttttcaattgaaggtgtcgatacgtta
gttccaatgcttcaacacacaatcacattagcaggtaacgaggggattaaaaacattcaa
atcggtatggctcaccgtggacgtttaaatgtattaacgcatgtcttggaaaaaccttat
gagatgatgatttcagaatttatgcatacagatccaatgaagtttttaccagaagatggt
agtttagaattaacttcaggttggacatcagatgtgaagtatcacctaggtggcgttaaa
acgactaactcatatggaatagaacaacgtatttctttagcgaataatccaagtcatttg
gaaatcgttgcacccgttgttgctggtaaaacaagagcagcacaagataatacacatcaa
gtaggaggtccatctaccgacttccataaagcaatgccgattattatacatggtgatgcg
gcatatccaggtcaaggtattaattttgaaacgatgaacttaggtagtttaaaaggatat
tctacaggtggttcacttcatattattacaaataatagaatcggttttacaactgaacct
tttgatggacgttcaacaacgtactcttccgacgtagctaaaggttacgatgttccaata
ctacacgtaaatgccgatgatgtagaagcaacaattgaagctattgaaattgcaatggag
ttccgtaaagaatttcataaagatgtagttattgatttagtaggttatcgtcgttatggg
cataatgaaatggatgagccttctattactaatccagttccataccaaaatattagaaaa
catgattcagttgaaattttatatggtaaaaagttagttgatgaaggtattatttctgaa
gacgaaatgaatgaagtcattgacagtgttcaaaaagaaatgcgaacagcacatgataaa
attgataaaaatgacaaaatgaataacccagatatggaaaaaccagaatcactccaacta
cctttacaaagtgatacgaaagatttctcatttgatcatttaaaagaaatcaatgatgca
atgcttgattatccaaaagattttcatgtactgaaaaagctcaataaagtacttgaaaaa
cgtagagaaccttttgaaaaagaaggggggctcgtcgattgggctcaagcagagcaactt
gcttttgcaaccatattacaagatggaacttcaattcgtttaacaggtcaagatagtgaa
cggggaacatttagtcatagacatgctgtgcttcatgatgaagaaaatggtaatacattc
acgccattgcatcatgtacctcaacaacaggctacttttgatattcataattcgccgcta
tctgaagcagctgtagttggatttgagtatggttataacgtcgaaaataaaggtaacttt
aacatatgggaagctcaatatggcgacttttctaatatgtctcaaatgatgtttgacaat
ttcctctcaagttctcgcgcaaaatggggtgagcgttcaggtttaacacttttcttacca
catgcttttgaagggcaaggaccagagcattcatcggcacgcttagaaagatttctacaa
ttagccgctgaaaataattcaactgtagttaatctatctagtgcaagtaattacttccat
ttactacgtgcgcaagccgctagtttagatacattagaaatgagaccattaattgtcatg
tcacctaagagtcttttaagaaataaaacagtagctaaacctattgatgagtttacatct
ggcggttttaaacctatcatcacagaagatatcgatgaacaaaaagtcaaaaaagtgatt
ttagcatcaggaaagatgtatattgacctaaaagaatatttagctaaaaatcctaacgat
tctattcttctcatagcagtagaaagattatatccgttcccagaagaagaaattaaagaa
gtattaaaatcgttacctcatcttgaaaatgtgtcatgggttcaagaagaacctaaaaat
caaggtgcatggttatttgtgtatccttatctaaaagcacttgttgctaataaatatgat
ttaacttatcacggtagaatacaaagagctgcacctgctgaaggcgatggagagattcat
aaacttgtacaaactaaaattattgaaagtagcattaacaattaa

DBGET integrated database retrieval system