KEGG   Staphylococcus epidermidis RP62A: SERP1456Help
Entry
SERP1456          CDS       T00229                                 

Gene name
aldA-1
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00010  Glycolysis / Gluconeogenesis
ser00071  Fatty acid degradation
ser00280  Valine, leucine and isoleucine degradation
ser00310  Lysine degradation
ser00330  Arginine and proline metabolism
ser00340  Histidine metabolism
ser00380  Tryptophan metabolism
ser00410  beta-Alanine metabolism
ser00561  Glycerolipid metabolism
ser00620  Pyruvate metabolism
ser00625  Chloroalkane and chloroalkene degradation
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ser00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP1456 (aldA-1)
   00053 Ascorbate and aldarate metabolism
    SERP1456 (aldA-1)
   00620 Pyruvate metabolism
    SERP1456 (aldA-1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SERP1456 (aldA-1)
   00561 Glycerolipid metabolism
    SERP1456 (aldA-1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SERP1456 (aldA-1)
   00310 Lysine degradation
    SERP1456 (aldA-1)
   00330 Arginine and proline metabolism
    SERP1456 (aldA-1)
   00340 Histidine metabolism
    SERP1456 (aldA-1)
   00380 Tryptophan metabolism
    SERP1456 (aldA-1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SERP1456 (aldA-1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SERP1456 (aldA-1)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SERP1456 (aldA-1)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SERP1456 (aldA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAW54852
UniProt: Q5HN16
LinkDB All DBs
Position
1521751..1523130
Genome map
AA seq 459 aa AA seqDB search
MTIIRDKFNNSKAFFNTHKTKNLKFRKQQLKLLSKNIKNHENELLDALYKDLGKSKVEAY
ATEISMLLKSIKLMRKELKNWSKTKQTDTPLYLFPTKSYIKKEPYGTVLIIGPFNYPVQL
VFEPLIGAIAAGNTAIVKPSELTPHVAIVIKDIIEDTFDEAYVSVVEGGIEETQALLSLP
FDYMFFTGSEKVGKIVYEAAARKLIPVTLELGGKSPVIVDDTANIKVASERISFGKFTNA
GQTCVAPDYILVQRKVKNDLIKALKKTIIEFYGENIEKSPDFGRIVNQKHFNRLNDLIQI
HKDNVVFGGNSSKEDLYIEPTLLDNITNDNKIMKEEIFGPILPIITYDNFDEVLEIIQSK
SKPLSLYLFSEDENMTHRVVEELSFGGGAINDTLMHLANPNLPFGGVGSSGIGQYHGKYS
FDTFSHMKSYTFKSTRLESSLFFPPYKGKFKYIKTFFKN
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacaataattagagataaatttaacaatagtaaagctttttttaatacgcataaaaca
aaaaaccttaaatttcgaaaacaacaacttaaattactaagtaaaaatatcaaaaatcat
gaaaatgaattattagatgccttatataaagatttaggtaaaagtaaggttgaagcatac
gcaaccgaaattagtatgcttttgaaaagcataaagttaatgcgcaaagagttaaaaaat
tggtcgaaaaccaaacaaacggatacaccactctacttattccctacaaagagttatatt
aaaaaagaaccctacggtacggtgcttattataggaccatttaattatccggttcaatta
gttttcgagcctctcatcggagcaatagctgccggaaatactgctatagttaaaccttca
gagttaacacctcatgttgccattgtgatcaaggacatcattgaagatacatttgatgaa
gcatacgtttctgttgttgaaggtggcattgaagaaacccaagcgttattaagtttacca
tttgattatatgttctttactggcagtgaaaaagtcggaaaaattgtttatgaagctgca
gcaagaaaattaattccagttactcttgaacttggcggtaaatcacctgtcattgtcgat
gatacagccaatatcaaagtagcgagtgaacgtattagttttggtaaatttactaatgct
ggtcaaacatgtgtcgctccagattatatattagttcagcggaaagttaaaaatgattta
ataaaagctcttaaaaaaacaattattgaattttacggagaaaatattgaaaaaagccct
gatttcggacggattgttaatcaaaaacactttaatcggttgaatgacttgattcaaatt
cataaagataatgttgtttttggaggtaatagttctaaagaagatttatatattgaacct
actttattggataacataaccaatgacaataaaatcatgaaagaagaaatattcggcccc
attttgcctattattacttatgataatttcgatgaagtacttgaaatcatccaaagtaaa
tcaaaaccactaagtttgtatctttttagcgaagatgaaaacatgacacatagagtggtt
gaagaattatcatttgggggcggtgcaattaacgatacgttaatgcatttagctaatcct
aacttacctttcggtggtgtaggttcttcaggcataggtcaatatcatggtaagtattct
tttgatacatttagtcatatgaaatcatacacatttaaatctacacgtctagaatcgagt
ttatttttccctccatataaaggtaaatttaaatatattaaaaccttcttcaagaactag

DBGET integrated database retrieval system