KEGG   Serratia sp. ATCC 39006: Ser39006_000575Help
Entry
Ser39006_000575   CDS       T05290                                 

Definition
(GenBank) shikimate kinase AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
sera  Serratia sp. ATCC 39006
Pathway
sera00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sera01100  Metabolic pathways
sera01110  Biosynthesis of secondary metabolites
sera01130  Biosynthesis of antibiotics
sera01230  Biosynthesis of amino acids
Module
sera_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sera00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ser39006_000575
Enzymes [BR:sera01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Ser39006_000575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin Cytidylate_kin2 dNK AAA AAA_16 AAA_22 TsaE His_biosynth APS_kinase ABC_tran AAA_25 AAA_5 AAA_7 AAA_24 AAA_17 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_28 AAA_29 RsgA_GTPase Mg_chelatase AAA_14 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: AUH02763
UniProt: A0A2I5T1I9
LinkDB All DBs
Position
complement(121746..122267)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDLEGEEGFR
DREEKVINELTEKQGIVLATGGGSIKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLHVETQPREVLEMLAKERNPLYEEIADVTIRTDEQSAKVVANQIISMLENN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
ggccgtcagttagctcagcaactcaatatggagttcttcgactccgatcaagaaattgag
cgacgcactggggctgatgtgggttgggtattcgacttggaaggcgaagaaggcttccgt
gatcgtgaagagaaagtcattaatgaattgacggaaaagcaagggatcgtcctggcgaca
ggcgggggctcaataaagtcgcgcgagactcgcaatcgtctttctgcgcggggcgtcgtc
gtttatctagaaacaaccattgagaagcaactggctcgcacacagcgcgataaaaaacgg
ccgttgcttcatgtcgagacacaaccgcgagaagtgctggaaatgttggcgaaagaacgt
aatcctttgtatgaagaaatcgctgatgtcactattcgcaccgatgaacaaagcgctaag
gtagttgctaaccagattattagtatgctggaaaacaactga

DBGET integrated database retrieval system