KEGG   Serratia sp. ATCC 39006: Ser39006_000610Help
Entry
Ser39006_000610   CDS       T05290                                 

Definition
(GenBank) carboxypeptidase/penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
sera  Serratia sp. ATCC 39006
Pathway
sera00550  Peptidoglycan biosynthesis
sera01100  Metabolic pathways
sera01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sera00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ser39006_000610
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Ser39006_000610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sera01003]
    Ser39006_000610
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sera01011]
    Ser39006_000610
Enzymes [BR:sera01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Ser39006_000610
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Ser39006_000610
Glycosyltransferases [BR:sera01003]
 Polysaccharide
  Bacterial polysaccharide
   Ser39006_000610
Peptidoglycan biosynthesis and degradation proteins [BR:sera01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Ser39006_000610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AUH02768
UniProt: A0A2I5T1N5
LinkDB All DBs
Position
126350..128908
Genome map
AA seq 852 aa AA seqDB search
MKFVKYFFILAVTCILLGAASLYGLYRYIEPQLPDVTTLKDIRLQTPMQVYSADGELIAQ
FGEKRRLPLKLDQIPPMLIHAFIATEDSRFYEHHGVDPQGILRAASVALISGHASQGAST
ITQQLARNFFLSPERTLLRKIKEAFLAIRIEQLLSKDEILELYLNKIYLGYRAYGVGAAA
QVYFGRPVDQLTLGEMAMIAGLPKAPSTFNPLYSYDRAVARRNVVLSRMLEENYITQAQY
DQARNEKLIADYHAPKISFSASYIAEMVRQEMVKRYGEDAYSDGYKVYTTITKKLQLAAE
ESLRNNVLAYDMRHGYRGASQRLWSAGMPAWPQEKIVDALKKLPVYGPLFPAVVIEAQAD
KAQALMADGNQIELPMAGIRWARAYKSDLSQGATPKQVTDVIQAGQQIWVRKVDNDWWLA
QIPEVNSALVSLNPNNGAILALVGGFDFNLSKFNRATQALRQVGSNIKPFLYTAAMDKGL
TLATILNDAPVTRWDPGAGSDWSPKNSPPVYQGPIRLRQGLGQSKNVVMVRAMRAMGVDY
AAKYLQRFGFPAQNIIHTESLALGAASFTPLQVVRGYAVMDNGGYLVDPHFISKIENETG
NTLYKATPKIVCTSCDLPVIYGDTPRSAILSDDNMENIATSKEPPVPGSSPVLQPDPITP
PEAAMQEANDYAPHVISTPLAFLIKDALNSNIFGGPGWMGTGWRAGKVLKRHDIGGKTGT
TNSSKDAWFSGYGPNIVASVWIGFDDHRRDLGRSTFSGVIHDQISGYEGGAKSAQPAWDD
FMKAALAGVPEQKTPVPPGIVSVLIDRSSGKLSNGGSNSRLEYFIDGTQPLDYGVHEAGT
TLMDNGQSKELF
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtattttttcatccttgcagtgacttgcatcctgttgggagctgcc
tcgctatatggtctttatcgctatatcgagccacaattacccgatgtcaccacactgaaa
gatatccggttgcagacaccaatgcaggtttacagtgctgacggagaactgattgcccag
ttcggtgaaaaacgccgtcttcccctgaagctggatcagataccgcctatgctgatccac
gcatttattgccactgaagacagtcggttctacgagcaccatggtgtagaccctcaaggt
attctccgggccgcatcggttgccctgatatctggccatgcttcgcaaggggccagtacc
attacccaacaattggcccgtaacttcttcctgagcccggaacgcacactgctgcgtaaa
atcaaagaagcgtttctggctatccgtatcgagcaattgttgagcaaggatgaaatcctt
gagctatatctcaacaaaatttatctcggttatcgcgcctatggtgtcggggctgcggca
caggtttatttcggccgccccgtagatcaactgacgctgggggaaatggcgatgattgcc
ggtctacctaaagcgccttctactttcaatccgctttactcttatgaccgtgccgtcgcc
cgtcgaaatgtggttctgtctcgtatgctggaggaaaactacatcactcaggcacagtat
gatcaggctcgtaacgaaaaactgattgcggattaccacgcaccgaagatttcgttttct
gcttcttacatagcggagatggtgcgtcaggaaatggtcaaacgttatggtgaagatgca
tacagcgatggctataaggtctacaccaccattacaaaaaaactccagctggctgcggaa
gagtcattacgtaacaacgtgctagcctatgatatgcgtcacggttaccgtggtgcgagc
cagaggttatggtcagcaggaatgcctgcctggccgcaagaaaaaatcgtcgatgcacta
aaaaaactgccggtttacggcccattatttcctgccgtcgtgatcgaagcccaggcagac
aaggctcaggccctgatggccgacgggaaccagatcgagttaccaatggccggtatacgc
tgggctcgggcctataaatctgatctctctcaaggtgcgacgccgaagcaggtcaccgat
gtgatccaggcaggtcagcagatttgggtaagaaaagtggataacgactggtggctggca
cagataccggaagtaaactcagcactggtttcactcaatccgaataatggcgctattctg
gcattggtgggtggttttgactttaacctgagcaaattcaaccgcgccactcaggcactg
cgccaagttggctcaaacatcaaaccattcctatacacggccgcgatggataaagggttg
acgctggctaccattctgaacgacgcgcctgtcacccgttgggatcctggcgcaggttca
gactggagccccaaaaactcgccaccggtttatcaaggccctattcgattacgtcaggga
ctcggtcaatctaaaaacgttgtcatggtgcgagccatgcgtgccatgggtgtcgattat
gcagcgaagtacctgcaacgtttcggcttcccagcacagaacatcattcataccgaatcg
ctggcgttgggcgccgcgtccttcacaccattgcaagttgtcagaggttacgccgtgatg
gacaacggtggctatctggttgaccctcactttatcagtaagatagaaaatgaaaccgga
aatacattatacaaagccacaccgaagatagtgtgtactagctgcgacctaccggtgatt
tatggtgatactccgcgttcagccatattgtctgatgacaatatggagaatatagcaaca
tcgaaggaaccccccgttcccgggagttcacccgttttgcagccggatcccattacacca
ccggaagctgccatgcaggaagccaatgattatgcgccccatgttatcagtacaccgctg
gcatttttgattaaagacgcattgaacagtaacatctttggcggaccaggctggatggga
acggggtggcgtgccggcaaggttctgaagcgccatgatattggaggcaaaacgggtacg
accaatagctcgaaagatgcctggttctccggctatggcccgaatattgttgcgtcagtc
tggatagggtttgacgaccatcgtcgcgacctcggccgaagtaccttttccggcgttatt
cacgatcaaatttccggttatgaaggtggtgccaagagcgcacaacctgcgtgggatgat
tttatgaaagccgcactggcaggcgtccctgaacagaagacacccgtaccaccagggatt
gtcagcgtgctcattgatcgcagcagcggcaagttgtcaaacggtggcagtaacagtcga
ctggaatacttcattgatggtacccaaccattggattatggcgttcatgaagcagggacg
acattaatggacaatggccaatcaaaagaactgttttag

DBGET integrated database retrieval system