KEGG   Serratia sp. ATCC 39006: Ser39006_001975Help
Entry
Ser39006_001975   CDS       T05290                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sera  Serratia sp. ATCC 39006
Pathway
sera00620  Pyruvate metabolism
sera00680  Methane metabolism
sera01100  Metabolic pathways
sera01120  Microbial metabolism in diverse environments
sera01200  Carbon metabolism
Module
sera_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sera00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ser39006_001975
  09102 Energy metabolism
   00680 Methane metabolism
    Ser39006_001975
Enzymes [BR:sera01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Ser39006_001975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AUH03016
UniProt: A0A2I5T2C7
LinkDB All DBs
Position
complement(425540..428179)
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGENILERVETIRKLSKSSRAGSEKHRKELLTTL
QNLSNDELLPVARAFSQFLSLANTAEQYHSISPHGEAVSNPENLAKVFQRLKDCDKLTEQ
NIRDAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHNDLADYERHQIMRRLRQ
LIAQSWHTDEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLRELDEQLEQSFGYRLPVDS
VPVRFTSWMGGDRDGNPNVTSAITRHVLLLSRWKAADLFLRDIQFLVSELSMTQCTPELQ
QLAGGESEKEPYRAVMKNLRTQLTNTLNYLEARLRGEQRARPQDLLVTNDQLWEPLYACF
QSLHACGMGIIADGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDALAEITRYLGLGDYES
WSESDKQAFLIRELSSKRPLLPHQWKPSAETQEVLETCNVIAETPQGSIAAYVISMARTP
SDVLAVHLLLKEAGCPFALPVAPLFETLDDLNNADSVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGGMAASWAQYRAQDALIKTCEKVGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYTGAILEANLLPPPEPKKEWHHVMDEL
SRVSCDMYRSYVRDNPDFVPYFRAATPELELGKLPLGSRPAKRRPDGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVIEDGGQDQLETMCRDWPFFSTRIGMLEMVFAKADLWLAE
YYDQRLVEEKLWPLGKKLREQLAADINVVLTIANDDHLMADLPWIAESIALRNVYTDPLN
VLQAELLHRSRQQEQPEPEVELALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagcaatgtcagtatgcttggcaaactgctcgga
gatacgattaaggatgcattgggagaaaacattcttgagcgtgttgaaacaatccgaaag
ttatcgaagtcatcccgtgccggcagtgaaaagcatcggaaagaactgctgacgacactg
caaaatctgtctaatgacgaactgttgccagtcgctcgcgcatttagccagtttttgagt
ctggctaacaccgctgagcaatatcatagtatctcgccccatggtgaagcggtcagtaac
ccggaaaatctggcaaaagtctttcagcgactgaaagactgcgacaaattgacggagcaa
aatatccgtgatgcggtggagtcactctccattgagctggttctcactgcgcacccgaca
gaaattacccgccgcaccctgattcataagttggtagaagtgaacacctgcctcaagcaa
ctggatcacaatgatctggctgattatgagcgccatcagatcatgcgtcgtctgcggcaa
ctgattgcccaatcctggcatacggatgaaatccgtaaaattcgccctacaccggtggat
gaagccaaatggggttttgcggtcgtggaaaatagtctgtgggaaggtgttcccgcgttt
ttgcgtgagttagacgaacagttggaacagtcgtttggttatcgcttaccggttgattcc
gttcccgtgcgctttacgtcatggatgggcggtgatcgtgatggcaatccaaacgttacg
tcagcaatcactcgccatgtactgttgctcagccgctggaaggcggcggatctgtttctg
cgtgatatccagttcctggtttccgaattatccatgacacagtgtacgccggagctacaa
cagttagctggcggagagagtgagaaggaaccttaccgggcggtcatgaagaatctgcgt
acccagttgactaatacgcttaattatctggaggcgcggctgaggggtgaacaacgggca
agaccgcaggacctgttggttaccaatgaccagttatgggaaccgctctacgcttgtttc
cagtctctgcatgcctgtggcatgggcattatcgccgacggtcaattactggatacttta
cgccgtgtgcgctgttttggtgtcccgctggtgcggattgacgtgcgtcaggaaagtacc
cgccatactgatgcgctggcggaaatcactcgttatctgggactgggtgactatgaaagc
tggtccgagtctgacaagcaggcgttcttgattcgtgagctcagttcaaaacgcccgctg
ctgccacatcagtggaaaccgagtgccgaaacgcaggaggtgctggaaacctgcaacgtt
atcgcggaaaccccgcaaggttccatcgccgcctatgtgatctccatggcgcgtacaccg
tctgacgtgctggcggtgcatctgctgttgaaagaagcgggttgcccgttcgctctgccg
gtggcgccgttgtttgaaacgttggacgatctgaacaacgctgacagtgtcatgacgcag
ttgctgaatattgactggtatcgcggttttattcagggcaaacagatggtgatgatcggt
tattccgattccgccaaagatgccggaggaatggctgcctcctgggcgcagtatcgtgca
caggacgccttgatcaaaacctgcgagaaagtcggcatagcgctgaccttgttccatggt
cgtggcggctctattggccgcggcggcgcaccggcgcatgcggcgttgttgtctcaaccg
ccaggaagcctgaaagggggcctgcgagtaacggagcagggcgagatgatccgtttcaag
ttcggtttgccggaagtcactatcagcagcctggcgctgtatactggcgccattctggaa
gccaacttgctgccgccgccggagccgaaaaaagagtggcaccatgtcatggatgagtta
tcccgcgtttcctgtgatatgtaccgtagttatgtacgggataatccggattttgtaccg
tatttccgggcggcgacaccggaactggagctaggtaaattgccgctgggctctcgcccg
gccaagcgtcgtcccgacggtggggttgaaagtttacgcgccattccgtggattttcgcc
tggacgcagaaccgcctgatgttgcctgcctggcttggcgccggtgcggcattgcagaaa
gtgattgaagacggagggcaggatcagttggaaaccatgtgccgcgactggccgttcttc
tccacccgtattggtatgctggaaatggtctttgccaaagcggatttgtggctggcggaa
tactacgaccagcgcctggtggaggaaaaactgtggccattgggtaaaaaactgcgtgaa
cagctggcggcggatatcaacgtggtgctgactatcgccaatgacgatcatctgatggct
gacttgccatggattgccgagtctattgcgttgcgtaatgtttacactgacccgctgaat
gtacttcaggcagagctgttgcaccgttctcgtcagcaggaacagccggagccggaagtg
gaactggcgctgatggttactattgccggtgtggctgccggtatgcggaacaccggttaa

DBGET integrated database retrieval system