KEGG   Serratia sp. ATCC 39006: Ser39006_006175Help
Entry
Ser39006_006175   CDS       T05290                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sera  Serratia sp. ATCC 39006
Pathway
sera00473  D-Alanine metabolism
sera00550  Peptidoglycan biosynthesis
sera01100  Metabolic pathways
sera01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sera00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ser39006_006175 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ser39006_006175 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Ser39006_006175 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sera01011]
    Ser39006_006175 (ddl)
Enzymes [BR:sera01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ser39006_006175 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sera01011]
 Precursor biosynthesis
  Amino acid ligase
   Ser39006_006175 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST ATP-grasp_3 ATP-grasp RimK TTL ATPgrasp_Ter ATPgrasp_YheCD GARS_A
Motif
Other DBs
NCBI-ProteinID: AUH03755
UniProt: A0A2I5TGQ1
LinkDB All DBs
Position
1335981..1336901
Genome map
AA seq 306 aa AA seqDB search
MTEKVAVLLGGISAEREVSLLSGQAVLSGLKEAGIDAYAVDIRDFPVIHLKDEGFTKAFI
ALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKRRTKLVWQASGLPVSPYVVLNRQ
QFLQMDSSRLIQQVAHLGMPLIVKPSREGSSVGMSKVEQADALHSALEEAFHHDDEVLVE
KCLSGPEFTVGILGDEVLPSIRIQATGTFYDYEAKYLSDETQYFCPSGLSDKQEHYLASL
AMDAYQALGCSGWGRVDVMMDSDGAFYLLEVNTSPGMTSHSLVPMAAKQRGFTFSQLVAR
ILELAG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaaagttgctgtactgcttggtggaatctccgctgaacgcgaagtctctttg
ctgtccgggcaggcagttctgtccggtctgaaagaggctggtattgatgcctatgctgtg
gatatccgtgatttcccggtcattcatttaaaggacgagggatttaccaaagcctttatc
gcgctccatgggcgcggtggtgaagacggtactttgcaaggtgtgctggaatttttacaa
ctgccctacactggcagtggtgttatggcctcggcacttacgatggataagcgccgtacc
aaactggtttggcaggcatcaggtttgcctgtttcaccttatgtggtcttgaaccgtcag
cagttcctgcaaatggattcgagccgtttgatacaacaggtggcacatctgggtatgccg
ttgatcgtgaagcccagccgtgaaggttccagcgttggtatgagtaaggttgaacaggct
gatgcgttgcactcagcactggaagaggcctttcaccatgatgatgaggtactggtcgag
aaatgtcttagcggaccggaattcacggttggcattctgggcgatgaggtactgccttct
atacggattcaggcaacaggtactttctatgactacgaggcaaagtacctgtcggatgag
acacagtatttctgcccgagtggcctgtctgacaaacaagagcactacctggcctctctg
gcgatggatgcataccaggctcttggttgcagtggctggggacgagtggatgtgatgatg
gacagcgatggcgcgttttatttactggaagtgaatacgtcgccgggaatgaccagccat
agtctggtgcctatggcggccaaacagcgtggcttcacgttctctcaattggttgccaga
attttggaattggctggttga

DBGET integrated database retrieval system