KEGG   Serratia sp. ATCC 39006: Ser39006_006780Help
Entry
Ser39006_006780   CDS       T05290                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sera  Serratia sp. ATCC 39006
Brite
KEGG Orthology (KO) [BR:sera00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ser39006_006780
Enzymes [BR:sera01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Ser39006_006780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored Glutaredoxin HI0933_like NAD_binding_8 DAO Thi4 FAD_binding_3 AlaDh_PNT_C K_oxygenase NAD_binding_7 FMO-like
Motif
Other DBs
NCBI-ProteinID: AUH03864
UniProt: A0A2I5TH12
LinkDB All DBs
Position
1473849..1475405
Genome map
AA seq 518 aa AA seqDB search
MLDNNMQIQLKAYLEKLTKPVELVATLDDSVKSSEVRQLLIEIAELSEKVSFFENNELSV
RKPSFLITNPGLATGPRFAGAPLGHEFTSLVLALLQTGGHPSKETQELLDQIRYLDGKFH
FETYYSLTCHNCPDVVQALNLMSILNPNITHTAIDGGVFQDEIKERNIMGVPTIFLNGEH
FGQGRMSLGEIVGKIDTGASDKLVEKLNNRPIYDVLVVGSGPAGAAAAVYAARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGAKLATALKSHVDDYDVDIIDLQSAQKLVPASEPG
MPHQIETVSGAVLRSRSIIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQDKLRSLPNVDVIMNAQTTEVLGD
GQKVIGLAYQDRVSSSIHKLALEGIFVQIGLLPNTNWLDGTVARNRIGEIEIDVKCETSV
KGIFAAGDCTTVPYKQIIIATGEGAKASLSAFDHLIRT
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaataacatgcagatccagctgaaagcctatctggaaaaattaaccaaaccg
gttgagctagtggcgacgctagatgattcggttaaatcttctgaagtccggcaactgctg
atcgaaattgccgaactatctgaaaaagtcagcttttttgaaaacaatgaactgtcggta
cgcaagccttcatttctgatcaccaatccgggattggcgaccgggcctcgctttgccggt
gccccgctgggacatgagttcacttcactggtgttggcgctgttgcagacggggggccat
ccgtcaaaagagactcaagaactgctcgaccagattcgctatctggacggtaaattccat
ttcgaaacctattactcgctgacctgtcacaactgtcctgatgtggtgcaggcactgaat
ttaatgtccatcctgaatccaaatattacccacaccgcaattgatggcggtgtgttccag
gatgagatcaaagaacgcaatattatgggcgtacccacgatatttctgaacggcgagcac
ttcggtcagggacgcatgagtctgggggaaattgtcggcaagattgataccggcgccagc
gataaactggtcgaaaagctcaacaatcgcccgatttatgatgtgttggttgtcggtagc
ggcccggcgggggcagcggcggcggtgtatgccgcccgtaaggggatccgtaccggactg
atgggggagcgttttggtgggcagattctcgataccgtagatattgaaaattatatctcg
gtaccgaaaactgaaggtgccaaattggccactgcgctaaaaagtcatgttgatgactat
gacgtggatatcattgatctacaaagcgcgcagaaactggtgccagccagtgaacctggc
atgccgcatcagattgaaaccgtatctggcgcggtactgcgatcccgcagcattatcatc
gcgaccggcgcccgctggcggaatatgaatgtgcccggtgaagatcagtatcgtactcgt
ggggtaacctactgtccgcactgtgatggccccttgttcaagggtaaacacgtggccgtg
atcggcggcggtaactccggcgttgaagccgctatcgatctggcgggggtggtgaaacac
gtgacgctactggagtttgcgccggaactgaaagcggattccgtgctacaggataaatta
cgcagcttgccaaatgtggatgtcatcatgaatgcgcagacgactgaagtgctgggggat
ggacaaaaggtcatcggactggcgtatcaggatcgcgtcagcagcagtattcataagctg
gcgctggaagggatcttcgtgcagatcggcctgttacccaacaccaactggctggacggt
accgtggcgcgtaaccgcatcggtgaaatcgagattgatgtcaaatgcgaaaccagtgtg
aaagggatcttcgctgccggtgactgtactaccgtgccgtacaaacagattattatcgcc
acgggtgaaggggccaaagcctcgctgagtgcctttgaccatttgatcagaacctaa

DBGET integrated database retrieval system