KEGG   Serratia sp. ATCC 39006: Ser39006_009320
Entry
Ser39006_009320   CDS       T05290                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sera  Serratia sp. ATCC 39006
Pathway
sera00030  Pentose phosphate pathway
sera01051  Biosynthesis of ansamycins
sera01100  Metabolic pathways
sera01110  Biosynthesis of secondary metabolites
sera01120  Microbial metabolism in diverse environments
sera01200  Carbon metabolism
sera01230  Biosynthesis of amino acids
Module
sera_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sera_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sera00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ser39006_009320
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Ser39006_009320
Enzymes [BR:sera01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Ser39006_009320
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-ProteinID: AUH04303
UniProt: A0A2I5TIB1
LinkDB
Position
2008773..2009696
AA seq 307 aa
MLSGRDACKAELVKCAEEDSTIICIEADLGGRDHPFLRRFPERFYNLGIAEMAALDICTG
FAEAGFKPFFTTFAPFVALRCAESLKLSMGYMGKAITVIGSYGGVCGGWFGTTHHCLEDV
GVVRLFPGIKIACPYGEAETRQVLREAAQATQPFYIRLGRNDRYPDLIQSSEFASLAMEQ
GYERRYQVTLVSIGEKATQLCVAAKQQLGEVNHLHLCYVDNLSLAKVIEQMTQLPGLFIV
AEEHRRTGSIAAELALSLPHRSIHSFTPSDDWPKFAGSQDDILTYLGFSLNTFVSFIKNI
IYKKEHL
NT seq 924 nt   +upstreamnt  +downstreamnt
atgctttcaggtagagatgcatgtaaagccgaattagttaaatgtgccgaggaagattca
acgattatctgcatcgaagctgatctaggtggtcgggatcatccgtttttacgccgtttc
cccgagcgtttttataatctcggcattgcagaaatggctgcgcttgacatatgcactggt
tttgctgaggcgggttttaaacccttctttacgacttttgcgccttttgtggctcttcgc
tgtgcagagtcactaaagctttcaatgggttatatggggaaggcaattacagtcattggt
tcttacggcggtgtatgtggagggtggtttggtacaacacatcattgcctcgaggatgtt
ggtgtggtccgtctttttcccggaattaaaattgcttgtccctacggtgaagcagagact
cgccaagtattacgtgaagccgcgcaggcgacacaacctttctatattaggttggggaga
aatgatcgctaccctgacctcattcaatccagtgagtttgcctcgctggcaatggaacag
ggttacgagcgccgatatcaggtcactctggtttctattggtgaaaaggcaactcagcta
tgcgttgcggcaaaacaacagttaggggaggttaaccatctgcacctttgctatgtcgat
aatctttcactggcaaaagttattgaacagatgacccagcttcctggtttgtttattgtt
gccgaggagcaccgccgtaccggaagtattgcggcggaattagcactgagcttgccgcat
agaagcatacattcctttaccccaagtgatgactggccaaaatttgctggctcacaagat
gacatactgacatatctgggtttctctctgaatacatttgtctcctttataaaaaacatt
atttataagaaggaacacctatga

DBGET integrated database retrieval system