KEGG   Serratia sp. ATCC 39006: Ser39006_020580Help
Entry
Ser39006_020580   CDS       T05290                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sera  Serratia sp. ATCC 39006
Pathway
sera00250  Alanine, aspartate and glutamate metabolism
sera00410  beta-Alanine metabolism
sera00430  Taurine and hypotaurine metabolism
sera00650  Butanoate metabolism
sera01100  Metabolic pathways
sera01110  Biosynthesis of secondary metabolites
sera01120  Microbial metabolism in diverse environments
sera02024  Quorum sensing
Module
sera_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sera00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Ser39006_020580
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ser39006_020580
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ser39006_020580
   00430 Taurine and hypotaurine metabolism
    Ser39006_020580
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Ser39006_020580
Enzymes [BR:sera01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Ser39006_020580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AUH06297
UniProt: A0A2I5TBQ1
LinkDB All DBs
Position
complement(4507950..4509332)
Genome map
AA seq 460 aa AA seqDB search
MPIHHVDLNNQSSRLDIYATKASQDSLPKYQLPKGRTEPRAAYALVRDELLLDGNARQNL
ATFCTTWVEDEVKQLMTDSIDKNMIDKDEYPQTAEIENRCVHIIADLWHANKSRKTVGCS
TTGSSEAAMLGGLAFKWAWRKRREAAGKDTSKPNIVTGPVQICWKKFARYFDVEIREVPL
EGDALGLKPEDLRQYCDENTIGVVATLGVTFTGIYEPVEALAKELDAMQRDLGLDIPIHV
DAASGGFIAPFIQRDLVWDFQLERVKSINASGHKYGLAPLGVGWVIWASQEDLPEELIFY
VDYLGGNMATFALNFSRPGGEIIAQYYNFLRLGREGYTAVQQACSDTAQWLGEKLAALEC
FEMVYDGHGGLPAVAYKLTDTVQGFTLYDLSERVRMGGWQIASYPLPMNRQETVVQRILI
RHGVSRDLAQLLLDDITRSIDHLTKNPILNSTAKPGFHHG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcctatccatcacgttgacttaaataaccagtccagccggttggatatttatgccacg
aaagcctcacaagacagcctccccaagtatcagcttccaaaaggtcgtactgaacctcgc
gccgcctatgcgctcgttcgggatgaacttttgctggatgggaatgcccgccagaacctc
gcaaccttctgcaccacgtgggtggaggacgaggtcaagcaactcatgaccgactcgatc
gacaaaaacatgatcgacaaagatgagtacccccaaacagccgaaatcgaaaatcgctgt
gtccacatcattgctgatctctggcacgcgaataaatctcggaaaacggtggggtgttca
acgaccggatcaagcgaggcggccatgctgggcggcctggcgttcaagtgggcatggcgt
aagcgccgggaagcagcaggtaaggatacgagcaagccaaacatcgtgacgggtccggtg
cagatctgttggaagaaattcgctcggtatttcgatgttgagatccgtgaggtgccactg
gaaggggacgcccttggtttgaaacctgaagacctgcgccagtattgcgacgaaaacacg
atcggtgtcgtggcgacgctgggtgtcaccttcaccggtatctatgaacccgttgaggcg
ctggcgaaggaactcgatgcaatgcagcgcgacctcgggctcgatattcctatccacgtg
gatgcggcgtccggcggattcatcgctcctttcattcagcgcgaccttgtctgggatttc
cagctagaacgcgtcaaatctattaacgcttctggccacaaatatggcctggcccccctt
ggtgtgggctgggtgatctgggcatcccaggaagacctgcccgaagagctgatcttctac
gtggattacctcggtggcaacatggccacattcgcgttgaacttctcgcgccccggcggt
gagatcatcgcgcaatattacaactttctgcgccttggtcgcgagggctataccgcggtc
cagcaagcctgctctgataccgcccaatggctgggtgaaaagttggcggcgctcgagtgt
tttgagatggtctatgatggtcatggcggtcttcccgcggttgcctacaagctaaccgat
acggttcaaggctttacgctttacgatctgtcggaacgggtacggatgggcggatggcag
atcgcctcctatccactgccaatgaaccgtcaggaaacggtcgttcaacgcatcctgatc
cgccatggggttagtcgggatctggcgcaactgcttctcgacgatatcacgcgatcgatc
gatcacctcacgaagaacccgattctgaactctacggcgaagccggggttccatcatggc
tga

DBGET integrated database retrieval system