KEGG   Serratia sp. ATCC 39006: Ser39006_022110Help
Entry
Ser39006_022110   CDS       T05290                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sera  Serratia sp. ATCC 39006
Pathway
sera00790  Folate biosynthesis
sera01100  Metabolic pathways
Module
sera_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sera00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ser39006_022110
Enzymes [BR:sera01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Ser39006_022110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AUH06568
UniProt: A0A2I5TPS7
LinkDB All DBs
Position
complement(4842785..4843618)
Genome map
AA seq 277 aa AA seqDB search
MKLTARGAILDLSCPQVMGILNVTPDSFSDGGKHATLDAALFHAQEMIAAGATLIDVGGE
STRPGANAVSVEEELSRVIPVVEALSQRFDTWISVDTSKPEVITASALAGAHLINDIRSL
QEPGALEAASATGLPVCLMHMQGLPETMQHAPHYDNLLDEVFAFFEHHIARCVNADLQKD
RLLLDPGFGFGKSLAHNYQILAHLKEMHRFGLPLLVGMSRKSMIGQVLNVPPLDRVHGSV
ACAVIAAMQGAHIIRVHDVKETVDAMRIVEATLSAEE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgactgccagaggagcgattttggatctctcctgtccacaggtgatgggtatt
ttaaatgttaccccggattctttctccgatggagggaagcacgccacattagatgccgcg
ctgttccatgcacaggagatgatcgcggcaggagcaacattgatcgacgtaggtggtgag
tcaaccagacctggagctaatgcagtaagtgtggaagaagagttatcacgagtaatcccc
gttgtagaggcactatcccagcgttttgatacctggatttccgtagatacgtcaaagcca
gaagtgatcactgcatcggcattggccggtgctcatttgattaatgatattaggtcatta
caggagcctggcgctctggaagccgcttcagctaccggattaccagtatgtctgatgcat
atgcagggattaccagaaaccatgcaacacgccccgcattatgacaatctgttggatgaa
gttttcgctttttttgagcatcatattgcacgttgtgtgaatgccgatctccagaaagac
aggcttttgttggatccggggttcggatttggcaaaagtctagcgcataattatcagata
cttgctcatctgaaggagatgcatcgctttggtttgccattgctggttggtatgtcgaga
aaatccatgattggtcaggtacttaatgttccgcctcttgaccgagtgcatggcagcgtt
gcctgcgcggttatagctgctatgcagggcgctcacattattcgcgttcatgatgtaaaa
gaaacggttgatgccatgcgcattgtagaagccacactttcagctgaggaataa

DBGET integrated database retrieval system