KEGG   Serratia sp. FS14: L085_02785Help
Entry
L085_02785        CDS       T03313                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
serf  Serratia sp. FS14
Brite
Translation factors [BR:serf03012]
 Eukaryotic Type
  Elongation factors
   L085_02785
 Prokaryotic Type
   L085_02785
Mitochondrial biogenesis [BR:serf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    L085_02785
Exosome [BR:serf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   L085_02785
  Exosomal proteins of breast cancer cells
   L085_02785
  Exosomal proteins of colorectal cancer cells
   L085_02785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Lsm_C cobW
Motif
Other DBs
NCBI-ProteinID: AIA46015
LinkDB All DBs
Position
complement(598874..600058)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSAYDFPGDDLPVIRGSALKALE
GEAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVNMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgttggtactatcggccac
gttgaccacggtaaaactaccctgactgcagcgatcaccaccgttctggctaaaacctac
ggcggttctgcacgtgctttcgaccagatcgataacgcgccagaagaaaaagctcgtggt
atcaccatcaacacctcccacgttgagtatgacaccccgactcgtcactacgcgcacgtt
gactgcccagggcacgccgactacgtgaaaaacatgatcaccggtgctgctcagatggac
ggcgcgatcctggtagtagctgcgactgacggcccaatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggttggcgttcctttcatcatcgtattcatgaacaaatgcgacatg
gttgatgatgaagagctgctggaactggtagaaatggaagttcgcgaactgctgtccgct
tacgacttcccaggcgacgacctgccggtaatccgcggttccgcgctgaaagcgctggaa
ggcgaagctgagtgggaagcgaaaatcatcgaactggccgaagccctggacagctacatc
ccagagccagagcgtgcaatcgacaagccgttcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgttgagcgcggtatcatcaaagttggc
gaagaagttgaaatcgttggtatcaaagacaccgttaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccaggctctatcaag
ccgcacacccagttcgaatctgaagtgtacatcctgagcaaagatgaaggtggtcgtcac
acgccattcttcaaaggctaccgtccacagttctacttccgtactactgacgtgaccggt
accatcgaactgccagaaggcgtagagatggtaatgccaggcgacaacgtgaacatggtt
gtaaccctgattcacccaatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgctggtgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system