KEGG   Serratia sp. FS14: L085_03230Help
Entry
L085_03230        CDS       T03313                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
serf  Serratia sp. FS14
Pathway
serf00564  Glycerophospholipid metabolism
serf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    L085_03230 (glpD)
Enzymes [BR:serf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     L085_03230 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_oxidored 3HCDH_N Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AIA46104
LinkDB All DBs
Position
689724..691232
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRTSLPGS
KGLRFGPESVLKPELKRGFEYSDCWVDDARLVVLNAQEVEKRGGEVRTRTKVTRAWRENG
LWMVEAVDIDSGKTFTWRAKGLVNATGPWVKNFFDDGLKLKSPYGIRLIKGSHIVVPRVH
DQPQSYILQNEDHRIVFVIPWNDEFSIIGTTDVEYKGDPKDVKIDENEIAYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDEQGKAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPGCGPAWTKNATLPGGDIDGDRDGYAAKLRRAHGWLPEALARRYART
YGSQSELILAGANGLADLGEDFGHGLYEAELRYLTEKEWVVELDDAIWRRTKLGMWLDEA
QQARVKAWLAEHAKTKALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggcggcatcaacggtgccggcatcgcggcg
gatgctgccgggcgcgggctgtcggtactgctactggaagcgcaagacttggcctgtgct
acgtcttccgccagttccaaactgatccacggtggcctgcgctacctggaacactacgaa
ttccgtctggtgagcgaagcgctggccgaacgtgaagtgctgctgaaactggcgccgcac
atcgcgttcccgatgcgtttccgcctgccgcaccagccgcacctgcgtccggcctggatg
atccgcatcggcctgttcctgtacgatcacctgggcaaacgcaccagcctgccgggcagc
aagggtttgcgctttggaccagagtcggtgctgaagcctgaactgaagcgcggtttcgaa
tattccgactgctgggtcgacgatgctcgcctggtggtgctgaacgcgcaggaagtggaa
aaacgcggcggcgaagtgcgcacccgcaccaaagtgacccgcgcatggcgtgaaaacggc
ctgtggatggtggaagcggtcgatatcgacagcggcaaaaccttcacctggcgcgccaaa
ggcctggtgaacgccaccggcccgtgggtgaaaaacttcttcgacgacggcctgaagctg
aaatcgccttacggcatccgcctgatcaaaggcagccacatcgtggtgccgcgcgtgcac
gatcagccgcagtcttacattctgcagaacgaagaccaccgcatcgtgttcgtgatcccg
tggaatgacgaattctccatcatcggcaccaccgacgtggagtacaaaggcgatccgaaa
gacgtgaagatcgacgagaacgaaatcgcttatctgctgaaagtgtacaacgatcacttc
aagaagcagctgggccgcgacgacatcgtctggacttactccggcgtgcgtccgctgtgt
gacgacgaatccgattcaccgcaggcgatcacccgcgattacacgctggacgtgcacgac
gagcagggcaaagcgccgctgctgtcggtgttcggcggcaagctgaccacctaccgcaag
ctggccgaacatgcgatggaaaaactggcccactactacccaggctgcggcccggcgtgg
accaaaaacgccacgctgccgggcggtgacatcgacggcgaccgcgacggttacgcggcc
aaactgcgccgtgcgcacggctggctgccggaagccctggcgcgccgttatgcccgcacc
tacggcagccagagcgagctgatcctggccggcgccaacggcctcgccgatctgggcgaa
gatttcggccacggtctgtatgaagccgagctgcgctacctgaccgagaaagagtgggtc
gtggagctggacgacgctatctggcgccgcaccaagctgggcatgtggctggacgaagcg
cagcaggcgcgagtgaaagcctggctggcggaacacgcgaaaacgaaagcgctgtctctg
gcttcctga

DBGET integrated database retrieval system