KEGG   Serratia sp. FS14: L085_03260Help
Entry
L085_03260        CDS       T03313                                 

Definition
(GenBank) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
serf  Serratia sp. FS14
Pathway
serf00260  Glycine, serine and threonine metabolism
serf00261  Monobactam biosynthesis
serf00270  Cysteine and methionine metabolism
serf00300  Lysine biosynthesis
serf01100  Metabolic pathways
serf01110  Biosynthesis of secondary metabolites
serf01120  Microbial metabolism in diverse environments
serf01130  Biosynthesis of antibiotics
serf01210  2-Oxocarboxylic acid metabolism
serf01230  Biosynthesis of amino acids
Module
serf_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
serf_M00017  Methionine biosynthesis, apartate => homoserine => methionine
serf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    L085_03260
   00270 Cysteine and methionine metabolism
    L085_03260
   00300 Lysine biosynthesis
    L085_03260
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    L085_03260
Enzymes [BR:serf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     L085_03260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AIA46110
LinkDB All DBs
Position
complement(701348..702451)
Genome map
AA seq 367 aa AA seqDB search
MKNVGFIGWRGMVGSVLMQRMTEERDFDAIRPVFFSTSQHGSAAPAFGGQQGTLQDAYDI
DALSALDIIITCQGGDYTNEVYPKLRASGWQGYWIDAASSLRMQDDAIIILDPVNHAVIQ
QGLDKGIKTFVGGNCTVSLMLMSLGGLFANDLVEWASVATYQAASGGGARHMRELLTQMG
MLHADVAKELQNPASAILDIERKVTEATRSGKLPTDNFGVPLAGSLIPWIDKQLDNGQSR
EEWKGQAETNKILNTASVIPVDGLCVRVGALRCHSQAFTLKLKKDVSLPEIEQMLATHND
WVRVIPNDRELTMRELTPAAVTGTLNTPVGRLRKLNMGPEYLSAFTVGDQLLWGAAEPLR
RMLRILL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgttggtttcatcggttggcgcggaatggtcggctcggttctcatgcaacgc
atgacggaagagcgcgatttcgacgccattcgcccggtctttttctccacctcgcagcac
ggttccgccgcgccggcctttggcggccagcagggcacgctgcaggatgcgtatgacatc
gacgcgctgagcgcgctcgatatcattattacctgtcagggcggcgattataccaacgaa
gtttatcctaagctgcgcgccagcggttggcagggttactggatcgacgcggcctcgtcg
ctgcgcatgcaggacgacgccatcatcatcctggatccggtcaaccacgcggtgatccag
cagggcctggacaaaggcatcaaaaccttcgtcggcggcaactgcaccgtcagcctgatg
ctgatgtcgctcggcggcctgttcgccaacgatctggtggagtgggcatcggtcgccacc
taccaggcggcctccggcggcggcgcgcgccacatgcgcgaactgctgacccaaatgggc
atgctgcatgccgacgtggcgaaagagctgcagaacccggcctccgccattctggatatc
gaacgcaaggtgaccgaggccacccgcagcggcaaactgccgaccgataacttcggcgtg
ccgctggccggcagcctgatcccgtggatcgacaagcagctcgacaacggccagagccgc
gaagagtggaaaggccaggctgaaaccaacaagatcctgaacaccgccagcgtgatcccg
gtcgacggtctgtgcgtgcgcgtcggcgcgctgcgctgccacagccaggcgttcacgctg
aagctgaaaaaagacgtgtcgctgccggaaatcgagcagatgctggcgacgcacaacgac
tgggtgcgcgtgatcccgaacgaccgcgaactgaccatgcgcgaactgacgccggcggcg
gtgaccggtacgctgaatacgccggtcggccgtctgcgcaagctgaatatggggccggag
tacctgtcggcgttcaccgtgggcgaccaactgctgtggggcgcggccgagccgctgcgc
cgcatgctgcgcatcctgctgtaa

DBGET integrated database retrieval system