KEGG   Serratia sp. FS14: L085_06215Help
Entry
L085_06215        CDS       T03313                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
serf  Serratia sp. FS14
Pathway
serf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    L085_06215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:serf02000]
    L085_06215
Enzymes [BR:serf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     L085_06215
Transporters [BR:serf02000]
 Other Transporters
  Pores ion channels [TC:1]
   L085_06215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AIA46694
LinkDB All DBs
Position
1380115..1380783
Genome map
AA seq 222 aa AA seqDB search
MIIVHHLNHSRSQRILWFLEELGVPYQVQRYERDPNTMLAPPALKKIHPLGKSPVIVDGD
LTLAESGAIIEYLQEAYDAQGMFMPTDFHARQQYRYWLHYAEGSLMPLLVMKLVFSRLGQ
PPIPWLLRPVAGAIGKGVQREYLDKQIAPHCEFLEQHLNKGSWFVGNDFSAADIQMSFPL
EAMAARGALDDCPKLRGFLQRIHARPAYQRALEQGGPYDLLS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttcatcatctcaatcactcgcggtcgcagcgcattctgtggtttctggaa
gagctgggcgtgccctatcaggtgcaacgctacgagcgcgatcccaacaccatgctggcg
ccgccggcgctgaaaaagatccacccgttgggcaaatcgccggtgatcgtcgatggcgat
ctgacgctggcggaatccggcgccattatcgaatacttgcaggaagcctacgacgcacag
ggcatgtttatgccaaccgacttccacgcgcgtcagcaataccgctactggctgcactac
gccgaaggatcgctgatgccgctgttggtgatgaagctggtgttcagccgtctcggccag
ccgccgatcccctggctgctgcggccggtggccggcgcgatcggcaaaggcgtgcagcgg
gaatacctcgacaagcagatcgcgccgcactgcgaattcctcgaacagcacctgaataag
ggcagttggttcgttggcaacgacttcagcgcggcggatattcagatgagcttcccgctg
gaggcgatggcggcgcgcggcgcgttggatgattgcccgaaactgcgcggcttcctgcag
cgcattcacgcccggcccgcctaccagcgggcattggagcagggcggcccttacgacctg
ctgagttag

DBGET integrated database retrieval system