KEGG   Serratia sp. FS14: L085_06865Help
Entry
L085_06865        CDS       T03313                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
serf  Serratia sp. FS14
Pathway
serf00250  Alanine, aspartate and glutamate metabolism
serf00410  beta-Alanine metabolism
serf00640  Propanoate metabolism
serf00650  Butanoate metabolism
serf01100  Metabolic pathways
serf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    L085_06865
   00650 Butanoate metabolism
    L085_06865
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L085_06865
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    L085_06865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:serf01007]
    L085_06865
Enzymes [BR:serf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     L085_06865
Amino acid related enzymes [BR:serf01007]
 Aminotransferase (transaminase)
  Class III
   L085_06865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIA46824
LinkDB All DBs
Position
1516577..1517842
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGVGVMCGFYAERAENATLWDVEGKEVIDFASGIAVLNTGHRHPK
VIAAIEKQLQAFTHTAYQIVPYESYVSLAERINQRAPIAGPCKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLDRLFKADIDPKQVAAIVLEPVQGEGGFNVAPADFMQALRALCDQHGILLIADEV
QTGFARTGKLFAMEHYSVKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEQLCQRAQRLGQHLVEVLQQARKTSPAIADVRAQGSMVAVEFND
PATGKPSADITRQVQQKAMEEGLLLLSCGVNGNVIRFLYPLTIPDDQFTKAMGILSRALA
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaattgaaccaacgccgtcaggacgccaccccgcgcggagtgggcgtg
atgtgtggtttttacgccgagcgcgcagagaacgccacgctgtgggatgtggaaggcaaa
gaagtgatcgacttcgcctcggggatcgccgtgctgaacaccgggcaccgtcacccgaag
gtgatcgccgcaattgaaaagcagctgcaggccttcacccacaccgcctatcagatcgtt
ccttacgaaagctatgtctcgctggcggagcgcatcaaccagcgcgcgccgatcgccggt
ccgtgtaaaaccgccttcttcaccaccggcgcggaagcggtggaaaacgcggtgaagatc
gcccgcgcttacaccggccgcccggggttgattaccttcggcggcggtttccatggccgc
acctacatgaccatggcgctgaccggcaaagtggcgccttacaaactgggctttggccca
ttccccggctcggtgttccacggccagtacccgaacgcgctgtacggcgtgaccaccgaa
gacgcgatgaacagcctggaccgcctgtttaaagcggatatcgatcccaagcaggtggcg
gcgatcgtgctggagccggtgcagggcgagggcggcttcaacgtggcgccggccgatttc
atgcaggcgctgcgcgcgctgtgcgaccagcacggcattctgctgatcgctgacgaagtg
cagaccggcttcgcccgcaccggcaagctattcgccatggaacactacagcgttaagccc
gatttgatcaccatggcgaaaagcctggcgggcggcatgccgctgtcggcggtggcgggc
cgcgccgaggtgatggacgcgccggcgccgggtgggctgggcggcacctacgccggtaac
ccgctggcggtggccgccgcgcacgcggtgctggacgtgattgaagaggagcaactgtgc
cagcgcgctcagcgcttgggtcagcacctggtggaagtgctccagcaggcgcgcaaaacc
agcccggcgatcgccgatgtgcgcgcgcaggggtcgatggtggcggtggagttcaacgat
ccggctaccggtaaaccttcagccgatatcacccgtcaggtgcagcagaaggcgatggag
gaagggctgctgctgctgagctgcggcgtgaacggcaacgtgatccgcttcctctaccca
ctgactatcccggacgatcagttcaccaaggcgatgggcatcctgtcccgcgcgctggcc
cactaa

DBGET integrated database retrieval system