KEGG   Serratia sp. FS14: L085_15315Help
Entry
L085_15315        CDS       T03313                                 

Definition
(GenBank) putative Zn-dependent and NAD(P)-binding oxidoreductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
serf  Serratia sp. FS14
Pathway
serf00040  Pentose and glucuronate interconversions
serf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    L085_15315
Enzymes [BR:serf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     L085_15315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AIA48484
LinkDB All DBs
Position
complement(3358364..3359398)
Genome map
AA seq 344 aa AA seqDB search
MKALVLAKAGEIAIEDVQLAETLGPDDVQIKIHSVGICGSDVHYYQHGRIGPFVVNAPMV
LGHEASGVVLATGKNVTHLSIGDRVCMEPGIPDLNSAQTRTGIYNLDPAVRFWATPPVHG
CLRETVIHPAAFTFKLPDNVSFAEGAMVEPLAIGMQAATKAGIKPGDIALVIGAGPIGVV
TALAALAGGCSDVIICDLFDEKLAVAASYEGLHAVNIKTGDLAGKVAALTSGNGADVVFE
CSGAKPAIATLAEHAAPGATAVLVGMPIDAAPMDIVAAQAKEITFKTIFRYANMYPRTLR
LLSSGKLRVQPLISQTYKFSDSVAAFERAAAGHASDIKIMLEME
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattagtgttggccaaggcgggggaaatcgctatcgaggacgtccagcttgcc
gaaacgctggggcccgatgatgtgcagataaaaattcattccgtgggcatctgcggcagt
gatgtgcactattaccaacatggccgcattggcccgttcgtggttaacgccccgatggtg
ctcggccatgaagcttctggcgtggtgctcgcgacaggtaaaaacgtcactcacctcagt
atcggcgatcgcgtttgcatggaacccggtattccggatctcaactcggcgcagacgcgc
accgggatttacaaccttgacccggccgtgcgcttctgggcgacgccgccggtgcacggc
tgcctgcgcgaaaccgtcatccaccccgccgccttcacgttcaaattgccggacaacgtc
agtttcgctgaaggcgccatggtggaacccttagccattggcatgcaagcagccaccaaa
gccgggatcaaacccggcgatatcgcgctggtgatcggcgccgggccgatcggcgtggtc
accgctctcgcggcgctggcgggcggctgctcggacgtcattatttgcgacctgtttgac
gaaaaactcgccgttgcggccagttatgaggggctgcacgccgtcaatatcaaaaccggc
gacctggcggggaaagtggccgcgctcaccagcggcaatggcgccgatgtcgtgtttgaa
tgcagcggcgcaaaaccggccatcgctacgctggccgaacatgcggcgccaggagcgacc
gccgtgctggtcggcatgccgatcgatgccgcgccgatggatatcgtcgccgcgcaggcc
aaggaaatcaccttcaagaccattttccgctacgccaacatgtacccgcgcacgctgcgg
ctgttgagcagcggcaaattgcgcgtccagccgttgataagccaaacctacaagttctcc
gacagcgtggccgccttcgagcgcgcggcggcgggacatgcctcggacatcaaaatcatg
ctggaaatggagtga

DBGET integrated database retrieval system