KEGG   Serratia sp. FS14: L085_18485Help
Entry
L085_18485        CDS       T03313                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
serf  Serratia sp. FS14
Pathway
serf00020  Citrate cycle (TCA cycle)
serf00480  Glutathione metabolism
serf01100  Metabolic pathways
serf01110  Biosynthesis of secondary metabolites
serf01120  Microbial metabolism in diverse environments
serf01130  Biosynthesis of antibiotics
serf01200  Carbon metabolism
serf01210  2-Oxocarboxylic acid metabolism
serf01230  Biosynthesis of amino acids
Module
serf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
serf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    L085_18485
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    L085_18485
Enzymes [BR:serf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     L085_18485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AIA49108
LinkDB All DBs
Position
complement(4028784..4030037)
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMIHVVDAAVKKAYHG
ERKISWMEIYTGEKSTHVYGKDVWLPDETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYQGTPSPVKQPELTDMVIFRENAEDIYAGIEWKAGSAEADKVIKFL
RDEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEG
AFKDWGYELAREEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGSDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIVKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaaaaaaatcacggttgacgcccagggt
aaactggttgttcctcataacccgatcattccgttcatcgaaggcgacggcatcggcgtt
gacgtgactcctgccatgatccacgtggttgatgcggccgttaaaaaggcttaccacggc
gaacgtaaaatctcctggatggaaatctacaccggcgaaaaatctacccacgtttacggt
aaagacgtgtggctgccggacgaaactctggacctgatccgcgactaccgcgtcgccatc
aaaggccctctgaccaccccggtcggcggcggcatccgttctctgaacgtggccctgcgc
cagcagctggacctgtacgtgtgcctgcgcccggtgcgttactaccagggcaccccaagc
ccggtgaaacagcctgagctgaccgacatggtgatcttccgcgaaaacgccgaagacatc
tacgccggcatcgagtggaaagccggctccgccgaagcggacaaagtgatcaaattcctg
cgcgacgaaatgggcgtgaagaaaatccgcttcccggagcagtgcggtatcggcgtgaag
ccatgctccgaagaagggaccaagcgtctggtgcgtgcggcgatcgaatacgccatcacc
aacgaccgtgactccgtgaccctggttcacaaaggcaacatcatgaagttcaccgaaggt
gccttcaaggattggggctatgagctggcgcgcgaagagttcggcggcgagctgatcgac
ggcggcccatggctgaagatcaagaacccgaacaccggcaaagagatcgtggttaaagac
gtgatcgccgacgccttcctgcagcagatcctgctgcgcccggcggaatacgacgtgatc
gcctgtatgaacctgaacggcgactacatctccgacgccctggcggcccaggtcggcggc
atcggcatcgcgccgggcgccaacatcggctccgactgcgccctgttcgaagcgactcac
ggcaccgcgccgaagtacgccggccaggacaaagtgaacccaggctccatcatcctgtct
gcagagatgatgctgcgccacatgggctggttcgaagcggctgacctgattgttaagggc
atggaaggcgccatcgctgccaagaccgtgacctatgacttcgaacgcctgatggaaggc
gctaagctgctgaaatgttcagagtttggcgacgctatcgttaaacacatgtaa

DBGET integrated database retrieval system