KEGG   Serinicoccus sp. JLT9: SGUI_0409Help
Entry
SGUI_0409         CDS       T04436                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
serj  Serinicoccus sp. JLT9
Pathway
serj00250  Alanine, aspartate and glutamate metabolism
serj00410  beta-Alanine metabolism
serj00640  Propanoate metabolism
serj00650  Butanoate metabolism
serj01100  Metabolic pathways
serj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:serj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGUI_0409
   00650 Butanoate metabolism
    SGUI_0409
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGUI_0409
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGUI_0409
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:serj01007]
    SGUI_0409
Enzymes [BR:serj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SGUI_0409
Amino acid related enzymes [BR:serj01007]
 Aminotransferase (transaminase)
  Class III
   SGUI_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANS77805
UniProt: A0A1B1N8U4
LinkDB All DBs
Position
442581..443831
Genome map
AA seq 416 aa AA seqDB search
MAHLSPLLKQATPVIAQRGEGAILWDEQDERYLDFTAGIGVTSTGHAHPDVVAAAQRQIG
KLIHAQYTTVMHRPLLDLVDRMSEVLPAGLDSMFFVNSGSEAVEAALRLARQATGRPNVI
TFHGGFHGRTVAAASMTTSGTKFRSGFAPLMPGVAVSPFPSPTHYGWSQEEATAFALREL
DYLLQTVSSPQDTAAFLVEPVLGEGGYVPASAEFLAGLRERADRHGILLVLDEVQTGWGR
TGRFWGHEHFGVTPDVLITAKGIASGFPLSGIAASEELMSKAWPGSQGGTYGANAVACAA
ALATLDVMQREDLVGNAAARGEQLRGRLQAAADGHTAITDVRGLGLMLGAEFRTADGTPD
GETAARAQQAAARHGLLLLTCGAWSQVVRFIPALVVTPEQVDEAGDLWEKALADVL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcacctcagcccgctgctcaagcaggccactcccgtcatcgcccagcgcggcgag
ggagccatcctctgggacgagcaggacgaacgctacctcgacttcaccgcgggcatcggt
gtgacgagcaccgggcacgcccaccccgacgtcgtggccgccgcgcaaaggcagatcggc
aagctcatccacgcgcagtacaccaccgtcatgcaccgtccgctgctcgacctcgtggac
cgcatgtccgaggtcctgcccgcgggcctggactcgatgttcttcgtcaactccgggtcg
gaggccgtcgaggccgcgctgcggctggcccggcaggcgaccggccggcccaacgtcatc
accttccacggcggcttccacgggcgcaccgtggccgcggcctccatgaccacctccggc
acgaagttccgctccggcttcgcgccgctcatgcccggcgtcgccgtctcccccttcccc
agccccacccactacggctggagccaggaggaggccaccgccttcgccctgcgcgagctg
gactacctgctgcagacggtgagctcgccgcaggacaccgcggccttcctcgtggagccg
gtgctcggtgagggcggctacgtgcccgcctcggcggagttcctcgccgggctgcgggag
cgcgccgaccggcacggcatcctgctcgtgctggacgaggtgcagaccggctggggccgg
accggccggttctgggggcacgagcacttcggcgtcacccccgacgtgctcatcaccgcc
aaggggatcgcctccggcttccccctctcgggcatcgccgcgtccgaggagctcatgagc
aaggcctggcccggctcccagggcgggacctacggggccaatgcggtggcctgtgccgcc
gccctggcgacgctcgacgtcatgcagcgcgaggacctcgtcggcaacgccgccgcccgc
ggcgagcagctccgcggccgcctgcaggccgcggcggacgggcataccgccatcacggac
gtgcgcgggctcggcctcatgctcggtgcggagttccgcaccgccgacggcaccccggac
ggcgagacggccgcccgcgcccagcaggccgccgcccggcacgggctgctgctgctgacc
tgtggcgcctggtcgcaggtcgtgcgcttcatccccgccctcgtcgtgacgccggagcag
gtggacgaggccggcgacctctgggagaaggccctggccgacgtgctctga

DBGET integrated database retrieval system