KEGG   Serinicoccus sp. JLT9: SGUI_1077Help
Entry
SGUI_1077         CDS       T04436                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
serj  Serinicoccus sp. JLT9
Pathway
serj00620  Pyruvate metabolism
serj00680  Methane metabolism
serj01100  Metabolic pathways
serj01120  Microbial metabolism in diverse environments
serj01200  Carbon metabolism
Module
serj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:serj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGUI_1077
  09102 Energy metabolism
   00680 Methane metabolism
    SGUI_1077
Enzymes [BR:serj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SGUI_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ANS78473
UniProt: A0A1B1NAL0
LinkDB All DBs
Position
complement(1189216..1192011)
Genome map
AA seq 931 aa AA seqDB search
MSDATSTDPISPELRADVRRVSTLLGQALVRHHGQDLLDTVEEVRLTAKASKEGDEQAAA
DVRRVLSGLPLDQATDLVRAFSAYFHLANAAEQVHRVRTHAARPEEEGWLTSAVRDVVEH
GGPELLASSVAELDMRPVFTAHPTEASRRSVLTKIRHLSDLLATTTEPDTQARRRQDREL
GELVDLIWQTDELRQNRPTPLDEARNAMYYLDEVLTTTMPALLGHLSDLLAEQDVRMDAS
RPPLRFGSWIGGDRDGNPFVTPAVTREVLRLQGSHAIKVALALVDVLISQVSSSTLVVDV
EQELLDSVQEDLAHLPGLDKRVLELNAQEPYRLKLTCVRAKLLNTRRRLEGGTPHEEGRD
YASTDEIVADLQVVADSLRRHGGELVADGRLAHATQTIAATGLHLATLDVREHSEKHHEA
LAPMLDAAGAAGEAGYDALDREARLELLGDELGSRRPLLTRAAPREQTLAVFDELREAVA
TYGEDVVETYIISMTQGPDDVLAAAVLAREAGLVDLHGDSGGEGAFALVGFAPLLETIDE
LRGAAALVDSMLSTPAYRELVRLRGDVQEVMLGYSDSNKQAGVLTSQWGIHQAQRALRDV
AAKHGVRLRLFHGRGGSVGRGGGPTYDAILAQPNGVLEGEIKFTEQGEVISDKYSLPALA
QENLELSLAAVLRASALHRDPRTTAEERERYDTVMDVTSDAAFAAYRSLIDDEDLPAYFV
AATPVDQLGALNIGSRPSKRPDTGKGLEGLRAIPWVFGWTQTRQIVPGWFGVGSGLRAAR
EAGHGEALHDMLEHWHFFRSVISNVEMTVAKTDLGIAAHYVDTLVPTELRHVFDTIRAEF
ELTVAELKELTGEEHLLDDQPTLKRTLAVRDNYLDPISYLQVELLRRLRDRPEEDEGEEA
AAGADEEEVDELQRALLVTVNGVAAGLRNTG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatgcgacgtccaccgaccccatcagccccgagctccgcgccgacgtccggcgg
gtctccaccctcctcggccaggccctcgtccggcaccacggccaggacctcctggacacc
gtcgaggaggtgcggctcaccgccaaggccagcaaggagggggacgagcaggccgccgcc
gacgtccgccgggtgctctccgggctccccctggaccaggcgaccgacctggtccgggcg
ttctcggcatacttccacctcgcgaacgccgccgagcaggtccaccgcgtgcgcacccac
gccgcccgccccgaggaggagggctggctgacctccgcggtgcgtgacgtcgtcgagcac
ggcggccccgagctgctcgcgagcagcgtcgccgagctggacatgcgcccggtcttcacc
gcgcacccgaccgaggcgtcacggcgcagcgtgctgaccaagatccggcacctgtccgac
ctgctcgccacgaccaccgagcccgacacgcaggcccggcgccgccaggaccgggagctc
ggcgagctggtcgacctcatctggcagaccgacgagctgcggcagaaccgcccgaccccg
ctcgacgaggcgcgcaacgcgatgtactacctggacgaggtgctcaccaccaccatgccc
gcgctgctgggccacctgtccgacctgctcgccgagcaggacgtgcgcatggacgcctcc
cgaccgccgctgcgcttcggcagctggatcggcggggaccgggacggcaacccgttcgtc
acgccagcggtgacccgcgaggtgctcaggctgcaggggtcgcacgccatcaaggtggcg
ctggccctcgtcgacgtgctcatctcccaggtctcctcctccaccctcgtcgtcgacgtc
gagcaggagctgctggactcggtgcaggaggacctcgcgcacctgcccgggctggacaag
cgggtgctggagctcaacgcccaggagccctaccggctcaagctcacctgcgtgcgggcc
aagctgctcaacacccgccgtcgcctcgagggcggcaccccgcacgaggagggtcgcgac
tacgcctcgacggacgagatcgtcgccgacctgcaggtggtcgccgactcgctgcgccgg
cacggcggggagctcgtcgcggacgggcgcctggcgcacgcgacccagaccatcgccgcg
accgggctgcacctcgcgacgctcgacgtgcgcgagcactccgagaagcaccacgaggcg
ctcgcgcccatgctcgacgcggccggtgccgcgggcgaggcgggctacgacgcgctggac
cgggaggcccggctggagctgctgggcgacgagctcggctcgcgccgcccgctgctcacc
cgcgccgccccccgggagcagacgctggcggtcttcgacgagctccgggaggccgtggcg
acctacggcgaggacgtcgtcgagacctacatcatctccatgacccagggaccggacgac
gtgctcgccgccgccgtgctggcgcgcgaggccgggctggtcgacctgcacggggactcc
ggtggcgagggggccttcgcgctcgtcgggttcgcccccctgctcgagaccatcgacgag
ctgcgtggtgccgccgcgctggtcgactcgatgctgtccaccccggcataccgcgagctg
gtgcgcctgcgcggggacgtgcaggaggtcatgctcggctactccgactccaacaagcag
gccggggtgctcaccagccagtggggcatccaccaggcgcagcgggcgctgcgcgacgtg
gccgccaagcacggggtgcggctgcggctcttccacggccgcggcgggtcggtcggccgc
ggcggcgggccgacctacgacgcgatcctggcccagcccaacggcgtgctcgagggagag
atcaagttcaccgagcagggcgaggtcatctccgacaagtactccctgcccgcgctcgcg
caggagaacctcgagctgtccctggccgcggtgctccgggcctccgcgctgcaccgcgac
ccgcggaccacggccgaggagcgggagcgctacgacacggtcatggacgtcaccagcgac
gccgccttcgcggcgtaccggagcctcatcgacgacgaggacctgccggcctacttcgtc
gcggcgaccccggtcgaccagctcggcgcgctcaacatcggcagccggcccagcaagcga
ccggacaccggcaaggggctggaggggctgcgcgccatcccgtgggtcttcgggtggacg
cagacgcggcagatcgtccccggctggttcggcgtggggtcggggctgcgggcggcgcgc
gaggccgggcacggcgaggcgctgcacgacatgctggagcactggcacttcttccgctcg
gtcatctccaacgtcgagatgaccgtggccaagaccgacctggggatcgcggcgcactac
gtcgacacgctcgtgccgaccgagctgcggcacgtcttcgacacgatccgtgcggagttc
gagctcaccgtcgccgagctcaaggagctcaccggcgaggagcacctgctcgacgaccag
ccgacgctcaagcggacgctggcggtgcgggacaactacctcgacccgatctcctacctc
caggtggagctgctgcggcggctgcgcgaccgcccggaggaggacgagggcgaggaggct
gcggcgggtgccgacgaggaggaggtcgacgagctgcagcgggcgctgctcgtcacggtc
aacggcgtcgcggcaggtctgcgcaacaccggctga

DBGET integrated database retrieval system