KEGG   Serinicoccus sp. JLT9: SGUI_1248Help
Entry
SGUI_1248         CDS       T04436                                 

Definition
(GenBank) ATP synthase beta chain
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
serj  Serinicoccus sp. JLT9
Pathway
serj00190  Oxidative phosphorylation
serj01100  Metabolic pathways
Module
serj_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:serj00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SGUI_1248
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:serj00194]
    SGUI_1248
Enzymes [BR:serj01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     SGUI_1248
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     SGUI_1248
Photosynthesis proteins [BR:serj00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SGUI_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N AAA T3SS_ATPase_C AAA_25 AAA_19 RsgA_GTPase ATPase ATPase_2 AAA_16 ABC_tran Dynactin_p22 NACHT DUF2806 NB-ARC LRV_FeS
Motif
Other DBs
NCBI-ProteinID: ANS78644
UniProt: A0A1B1NB67
LinkDB All DBs
Position
complement(1381508..1382965)
Genome map
AA seq 485 aa AA seqDB search
MTATTEAPSTEQTQGAVGRLARIIGPVVDVEFPPGQMPALYNLLKTEVEVGGDTKTVNLE
VAQDIGDNMVRAISLQPTDGLVRGAQVQDTGGPITVPVGDVTLGHVFNATGDVLDLPEGE
TLEVNERWGIHRQAPAFDQLESKTQMFETGIKVIDLLTPYVQGGKIGLFGGAGVGKTVLI
QEMIARVARDHGGVSVFAGVGERTREGNDLIVEMEEAGVLGQTALVFGQMDEPPGTRLRV
ALSALTMAEYFRDVQKQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPNLADEMGTL
QERITSTRGHSITSMQAIYVPADDYTDPAPATTFAHLDATTELSRPIASQGIYPAVDPLT
STSRILDPRYISQEHYDTAVRIKSILQRYKELQDIIAILGIDELSEEDKILVGRARRIQR
FLSQNTYVAKQFTGIEGSTVPLSETIEAFTKVADGDYDHLPEQAFFMCGGLEDVERQAAE
LEKNS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactgctaccaccgaggctcccagcacggagcagacccagggcgccgtgggtcggctg
gcccggatcatcggccccgtcgtcgacgtcgagttcccccccggacagatgccggcgctc
tacaacctgctgaagaccgaggtcgaggtgggcggggacaccaagaccgtcaacctcgag
gtcgcccaggacatcggcgacaacatggtgcgcgccatctccctgcagccgaccgacggc
ctcgtccgcggtgcgcaggtgcaggacaccggcggccccatcaccgtaccggtcggcgac
gtgaccctcgggcacgtcttcaacgccaccggggacgtgctcgacctgcccgagggggag
accctcgaggtcaacgagcgctggggcatccaccgccaggctccggccttcgaccagctg
gagtccaagacccagatgttcgagaccggcatcaaggtcatcgacctgctgaccccctac
gtgcagggcggcaagatcggcctgttcggcggggccggggtcggcaagacggtgctcatc
caggagatgatcgcccgtgtcgcccgcgaccacggcggtgtgtccgtcttcgccggcgtg
ggtgagcgcacccgcgagggcaacgacctcatcgtcgagatggaggaggccggcgtcctc
ggccagaccgccctggtcttcggccagatggacgagccgccgggcacccggctgcgggtc
gcgctgtccgcgctgacgatggcggagtacttccgcgacgtccagaagcaggacgtgctg
ctcttcatcgacaacatcttccgcttcacccaggccgggtccgaggtgtcgacgctgctg
ggccgtatgccctccgccgtcggctaccagccgaacctcgccgacgagatgggcacgctg
caggagcggatcacctccacccgtggtcactcgatcacctcgatgcaggcgatctacgtg
ccggccgacgactacaccgacccggccccggcgaccaccttcgcccacctggacgcgacg
accgagctgtcccgcccgatcgcctcgcagggcatctacccggccgtggacccgctgacc
tcgaccagccggatcctcgacccgcgctacatcagccaggagcactacgacaccgcggtc
cggatcaagtcgatcctgcagcgctacaaggagctgcaggacatcatcgcgatcctcggt
atcgacgagctctccgaggaggacaagatcctcgtcggccgcgcccgtcgcatccagcgg
ttcctgtcgcagaacacctacgtcgccaagcagttcaccggcatcgagggctcgaccgtg
ccgctgagcgagaccatcgaggccttcaccaaggtcgccgacggtgactacgaccacctc
ccggagcaggccttcttcatgtgcggtggcctcgaggacgtcgagcgccaggcggccgag
ctggagaagaacagctga

DBGET integrated database retrieval system