KEGG   Serinicoccus sp. JLT9: SGUI_1450Help
Entry
SGUI_1450         CDS       T04436                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
serj  Serinicoccus sp. JLT9
Pathway
serj03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:serj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SGUI_1450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:serj03400]
    SGUI_1450
Enzymes [BR:serj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SGUI_1450
DNA repair and recombination proteins [BR:serj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SGUI_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ANS78846
UniProt: A0A1B1NBP4
LinkDB All DBs
Position
1602655..1603503
Genome map
AA seq 282 aa AA seqDB search
MSSQQVSVAGRTLKVSNLDKVLYPATGTTKGEILTYYVTHAEQILPELADRPVTRIRWPE
GVAQAHFFEKNLPSGAPDWLPRVVVPTPGSSRGHTHLTFPLVTDLADLVYLVNLGSLELH
VPQWRIDGDGVPQDPDRLVVDLDPGPGAGLAECSRVALLVRDRLGAVGLEARPVTSGSKG
MQLYAALEGTRSSDEVSAVTKALAESLAEQHPDLVTARMTKAVRPGKVFLDWSQNNGAKT
TICPWSVRGRERPQVAFPRDWDEVEGAAEGDEELVQVLIDEV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagccagcaggtcagcgtcgccgggcgcacgctcaaggtgagcaacctggacaag
gtgctctaccccgccaccggcacgaccaagggcgagatcctcacctactacgtcacccac
gccgagcagatcctgcccgagctggccgaccggccggtcacccggatccggtggccggaa
ggcgtcgcgcaggcgcacttcttcgagaagaacctcccctccggagcacccgactggctg
ccccgggtcgtcgtccccacgcccgggtcctcgcgcgggcacacccacctgacgttcccg
ctggtcaccgatctggcggacctggtctacctcgtcaacctcggcagcctcgagctgcac
gtgccgcagtggcggatcgacggcgacggcgtcccgcaggacccggaccggctggtggtc
gacctcgacccgggtcccggcgccgggctcgccgagtgctcccgggtggcgctgctggtg
cgcgaccggctgggtgcggtggggctcgaggcgcgcccggtcacgagcgggtccaagggc
atgcagctgtatgccgcgctcgagggcacccggagctcggacgaggtgagcgctgtcacc
aaggcgctggccgagagcctggccgagcagcaccccgacctggtgacggcgcggatgacc
aaggcggtgcggcccgggaaggtcttcctcgactggagccagaacaacggggcgaagacg
acgatctgcccgtggtccgtgcggggcagggagcggccgcaggtggccttcccgcgcgac
tgggacgaggtcgagggcgccgccgagggggacgaggagctcgtgcaggtgctcatcgac
gaggtgtaa

DBGET integrated database retrieval system