KEGG   Serinicoccus sp. JLT9: SGUI_3048Help
Entry
SGUI_3048         CDS       T04436                                 

Definition
(GenBank) Nickel-dependent superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
serj  Serinicoccus sp. JLT9
Brite
KEGG Orthology (KO) [BR:serj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SGUI_3048
Enzymes [BR:serj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SGUI_3048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: ANS80444
UniProt: A0A1B1NGA0
LinkDB All DBs
Position
complement(3323836..3324237)
Genome map
AA seq 133 aa AA seqDB search
MFTRFFAPTIEVSAHCDLPCGVYDPAQARIEAESVKKICEKVADNDDADFRMRAMIIKEQ
RSELVKHHLWVLWTDYFKPPHFEQFPELHVLVNEATKLAGASGTKGSFDVATADELLGKI
DRIAEIFAETKKG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccaggttcttcgcccccacgatcgaggtcagcgcgcactgcgacctgccctgc
ggcgtctacgaccccgcccaggcccggatcgaggccgagtcggtcaagaagatctgcgag
aaggtcgcggacaacgacgacgccgacttccgtatgcgcgccatgatcatcaaggagcag
cgctcggagctggtcaagcaccacctgtgggtgctgtggaccgactacttcaagccgccg
cacttcgagcagttcccggagctgcacgtgctggtcaacgaggccaccaagctggccggc
gcctcgggcaccaagggcagcttcgacgtcgcgacggccgacgagctgctgggcaagatc
gaccgcatcgcggagatcttcgccgagaccaagaagggctga

DBGET integrated database retrieval system