KEGG   Serratia sp. MYb239: CLM71_00195Help
Entry
CLM71_00195       CDS       T05477                                 

Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
serm  Serratia sp. MYb239
Brite
Enzymes [BR:serm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CLM71_00195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AVJ15688
UniProt: A0A2R3GVJ1
LinkDB All DBs
Position
complement(46211..46834)
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASLSVEELIKD
LDKVPADKRTFMRNNAGGHANHSFFWKNLKTGTSLSGDLKAAIERDFGSVEKFQEEFEKA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVAGASGFPIIGLDVWEHAYYLKYQ
NKRPDYIKAFWNVVNWDEAAARFAAKK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcactgccgtacgcctatgacgcgctggaaccgcactttgac
aagcagacgatggagatccatcacaccaaacaccatcagacctacgtcaacaacgccaac
accgtgctggaagcctacccggaactggcttccctgagcgttgaagagctgatcaaagac
ctggataaagtcccggccgacaagcgcacctttatgcgcaacaacgccggcggccacgcc
aaccacagcttcttctggaaaaacctgaaaaccggcacctccctgtccggcgatctgaaa
gccgccatcgagcgtgacttcggcagcgtggagaaattccaggaagagttcgagaaagcc
gccgccacccgcttcggctccggctgggcctggctggtgctgaaagacgacggcaaactg
gcggtggtgtctaccgctaaccaggacagcccgctgatgggcgaagccgttgccggcgca
tccggtttcccgattatcggcctggacgtgtgggaacacgcttactacctgaaatatcag
aacaaacgtccggactacatcaaagcattctggaacgtggtgaactgggacgaagccgcc
gcgcgtttcgccgccaagaagtaa

DBGET integrated database retrieval system