KEGG   Serratia sp. MYb239: CLM71_03475Help
Entry
CLM71_03475       CDS       T05477                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
serm  Serratia sp. MYb239
Pathway
serm00471  D-Glutamine and D-glutamate metabolism
serm00550  Peptidoglycan biosynthesis
serm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CLM71_03475
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CLM71_03475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:serm01011]
    CLM71_03475
Enzymes [BR:serm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     CLM71_03475
Peptidoglycan biosynthesis and degradation proteins [BR:serm01011]
 Precursor biosynthesis
  Amino acid ligase
   CLM71_03475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AVJ16259
UniProt: A0A2R3GXB4
LinkDB All DBs
Position
751892..753367
Genome map
AA seq 491 aa AA seqDB search
MNTQQLAKLRTIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDLAPNPVTQQL
SALGATIYFNHRPENVLDASVVVVSTAIASDNPEIVAAREARIPVIRRAEMLAELMRFRH
GIAVAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGTHARLGCSRYLIAEADESDA
SFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLPFYGRAVMCIDDPVVRELL
PRVGRHITTYGFSEDADVRIESYSQIGPQGHFTLSRQDKPQMTVTLNAPGRHNALNAAAA
VAVATEEGIDDEDILRALAGFQGTGRRFDFLGEFALDAVNGSAGSAMLVDDYGHHPTEVD
ATIKAARAGWPDKRLVMVFQPHRYTRTRDLYDDFANVLSQVDVLLMLEVYPAGEAPIPGA
DSRSLCRTIRNRGKLDPILVSDADTVPETLAQLLQADDLVLVQGAGNVGKIARNLAELKL
QPQNKEEQPHD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacaacaactggcgaaactacgtacaatcgtgcccgagatgcgtcgcgtccgg
cacattcactttgtcggcatcggtggtgccggcatgggtggtatcgccgaagtgttggct
aatgaagggtatcaaatcagcggttcggatctggcgccgaatccggtgacccagcagctg
agcgcgctgggggcgacgatctatttcaaccatcgtccggagaatgtgctggatgcgagc
gtagtggtggtctccaccgccattgcttctgacaaccctgagatcgtcgcggcgcgtgaa
gcacgcattccggtgattcgccgtgccgaaatgctggccgaactgatgcgctttcgtcac
ggcatcgccgtggccggtacgcacggcaaaactaccaccaccgcgatggtgtccagtatt
tatgcggaagccggtctggatccgaccttcgtcaacggcggtctggtgaaggcggcgggc
acgcacgcgcgcctcggctgcagccgttatctgattgcagaggctgacgaaagcgacgcg
tcgttcctgcacctgcagccgatggtggcgattgtcaccaatatcgaagccgaccacatg
gacacttaccatggcgactttgaaaacctgaagcagacgtttatcaacttcctgcacaac
ctgccgttctacggccgtgcggtgatgtgcattgatgacccggtggtgcgtgaactgttg
ccgcgcgtcgggcgtcatattactacgtacggttttagcgaagatgccgacgtgcgtatt
gagagctacagccagattggcccgcaggggcactttaccctgagccgtcaggataagccg
cagatgacggttaccctgaacgcgccgggacgtcacaatgcgctgaacgcggcggcggcg
gtggccgtggctaccgaagagggcattgacgacgaggacattttacgtgcgctggccggc
ttccagggtaccggacgccgtttcgacttcctgggcgagttcgcgctggatgcggtgaac
ggcagcgcaggcagcgcgatgctggtggacgactacggccaccatccgactgaggtggac
gccacgatcaaagcggcacgcgccggctggccggataaacgcctggtgatggtgttccag
ccgcatcgctatacccgcacccgcgacctgtacgatgactttgccaacgtgctgtctcag
gtggacgtgctgctgatgctggaggtctatccggcgggtgaagcgccgattccgggcgcg
gacagccgttcgctgtgccgcaccatccgtaaccgcggcaagctggacccgattttagtg
tccgacgcggataccgtgccggaaacgctggcccagctgctgcaggcggatgacctggtg
ctggtgcagggtgcgggcaacgtcggcaaaattgcccgtaatctggcggagctgaagctg
cagccgcagaacaaagaggagcagccgcatgactga

DBGET integrated database retrieval system