KEGG   Serratia sp. MYb239: CLM71_08485Help
Entry
CLM71_08485       CDS       T05477                                 

Definition
(GenBank) D-amino-acid oxidase
  KO
K21061  D-hydroxyproline dehydrogenase subunit beta [EC:1.5.99.-]
Organism
serm  Serratia sp. MYb239
Pathway
serm00330  Arginine and proline metabolism
serm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CLM71_08485
Enzymes [BR:serm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     CLM71_08485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 GIDA NAD_binding_8 FAD_binding_2 FAD_oxidored NAD_binding_9 Thi4 3HCDH_N ApbA Lycopene_cycl HI0933_like ThiF Pyr_redox FAD_binding_3 UDPG_MGDP_dh_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AVJ17169
UniProt: A0A2R3GZX9
LinkDB All DBs
Position
1810329..1811444
Genome map
AA seq 371 aa AA seqDB search
MKCADVIVVGAGIIGSACAWQLARRGLRVALVDDGRPGATAAGMGHLVCMDDNPAELALC
AYSLRLWRELAAQMPAHCAWRGCGTLWLAEHDDELALAEQKQQRLAAAEAESYLLSAGEL
RRREPQLRHGLAGGLHVPGDGIVYAPNVARWLVEQGKEAIVRYRGSAVALEPQTVLLADG
TRLTADAVLLACGLAANALLAEPLLRAKKGQLAITDRYPPQVRHQLVELGYGASAHASGG
TSVAFNLQTRPTGQLLIGSSRQFDVPDDVLDMSLLATMLQRATQFVPSLAQMNIIRCWTG
QRAASADGLPLLGPHPVHDGLWLALGHEGLGVTTALGSAALIADRLLRQRPAIDDTPYLP
ARLLAAEEVSA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcgccgacgtgattgtggtcggcgccgggattatcggcagcgcctgcgcctgg
caactggcgcggcggggattgcgggtggcgctggtggatgacggccggccgggggcgacc
gcggcgggaatggggcacctggtctgcatggatgacaacccggccgagctggcgctctgt
gcctattcgctgcgcctgtggcgcgagctggccgcccagatgccggcgcattgcgcctgg
cgcggctgcggtacgctgtggctggcggaacatgacgatgagctggcgctggcggagcaa
aaacagcagcggttggccgccgcagaggcggagagttatctgctcagcgccggcgaactg
cggcgacgtgagccgcagttgcgtcacggcttggccggcgggctgcacgttcccggcgac
ggcattgtatacgcgccgaatgtggcccgctggctggtagagcaggggaaagaggcgatc
gtgcgctatcgcggcagcgccgtggcgctggagccgcagacggttctactggccgacggc
acgcggctgacggccgatgcggtgctgctggcgtgcggcttggcggccaatgcgctgctg
gcagagccgctgctgcgggccaaaaaggggcagttggcgattaccgatcgttatccgccg
caggtccgtcatcaactggttgaactggggtacggcgccagtgcgcacgccagcggcgga
acctccgtggcgtttaatctgcagacgcgccccaccggccagttgctgatcggttcttcg
cgtcagtttgatgtgccggacgacgtgttggatatgtcgctgctggcgacgatgctgcag
cgggcgacgcagtttgtaccgtcgctggcgcagatgaatatcatccgctgctggaccggc
cagcgcgctgcgtcagcggacgggctgccgctgttgggccctcatccggttcatgacggc
ctgtggctggcgctggggcatgagggcctgggcgtaaccaccgcgctcggcagcgcggcg
cttatcgctgaccgcctgttgcgacagcgcccggcgattgacgatacgccctacctgccg
gcccggctgctggcggctgaggaggtttccgcatga

DBGET integrated database retrieval system