KEGG   Serratia sp. MYb239: CLM71_10835
Entry
CLM71_10835       CDS       T05477                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
serm  Serratia sp. MYb239
Pathway
serm00480  Glutathione metabolism
serm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CLM71_10835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:serm02000]
    CLM71_10835
Enzymes [BR:serm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CLM71_10835
Transporters [BR:serm02000]
 Other transporters
  Pores ion channels [TC:1]
   CLM71_10835
SSDB
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_N_2 GST_C_2 Glutaredoxin2_C GST_C_6 GST_N_5
Other DBs
NCBI-ProteinID: AVJ17598
UniProt: A0A2R3H0Y8
LinkDB
Position
complement(2258145..2258750)
AA seq 201 aa
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLVSKTTESGADYLAINPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRQLIPPAGTLSRYHAIEWLNFVATELHKGFTPLFNPKTPEA
YLAMARAKLEQHFHYLDDVLAQQHYLLGSRFCVADAYLFTVLRWAVALQFDLQPYPHLTG
YMKRVAARPAVAAALNAEGLQ
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaactgttctataaagccggcgcctgttccctgtctccgcatatcgtgctgcgcgag
gcggggctggacttcaccgcggaaaaagtcgatctggtcagcaaaaccaccgagagcggc
gccgactatctggcgattaaccctaaaggacaggttccggcactgctgctggatgacggc
agtctgctgaccgaaggcgtggcaatagtgcagtatctggcggatcgggtgcccgaccgt
caactgattccgccggcgggcacgctgtcgcgctaccatgcgatcgagtggctgaacttt
gtcgctacggagctgcacaagggctttaccccgctgttcaaccctaaaacgccggaagcg
tatctggcgatggcgcgcgccaagctggagcagcatttccactatctcgacgacgtgctg
gcgcagcaacactacctgctgggcagccgcttctgcgtggcggacgcctacctgtttacc
gtgctgcgctgggcggtagcgctgcagttcgatctgcagccctatccgcacctgaccggc
tatatgaagcgcgtggcggcacgcccggcggtcgccgcagcgctgaatgccgaaggtttg
cagtaa

DBGET integrated database retrieval system