KEGG   Serratia sp. MYb239: CLM71_14285
Entry
CLM71_14285       CDS       T05477                                 

Definition
(GenBank) type VI secretion system protein TssL
  KO
K11892  type VI secretion system protein ImpK
Organism
serm  Serratia sp. MYb239
Pathway
serm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:serm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CLM71_14285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:serm02044]
    CLM71_14285
Secretion system [BR:serm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CLM71_14285
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: AVJ18221
UniProt: A0A2R3H3D2
LinkDB
Position
2971689..2972912
AA seq 407 aa
MTQENIQAAQWDNPLVAAANPLLNAISQIRQSATHANPAQLRQQLIDEVRRFEVRGQRAN
LPYEVIIGARYCLCTALDEAAALTPWGSNSVWSGSGLLVTFHNETWGGEKFFQLLAKLSQ
SPREHINLLELVNYCLLLGFEGRYRVMENGRSQLETMKQRLLQLIRSVRGGYAPPLSPNA
VDLPVQQKLWRPLVPLWACAALTGFLASLLFIVLNWRLGDATSPVLASIYQTNLPQVTIG
NPAPAAPPVLSLKSFLRKEIAEGLVVVRDEAQQSVVILKGDGLFNSAATSVRPAYIPVID
RIAKAMNGVSGKILVTGYSDSQPIRSARFASNWELSLARAEAVSERLQKHLDNPQRVKAE
GRGESNPVAPNNSKENRALNRRVEITLLVAPENTQAEINGLQQGNGK
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgacacaggaaaacatccaggccgcgcagtgggataacccgttggtggccgccgccaat
ccactgttgaatgcgatctcgcaaatccggcagtcggcgacgcacgctaatccggcgcag
ctgcgtcagcaattgatcgatgaagttcgccgttttgaagtccgcggccaacgcgccaat
ctgccgtatgaagtgattatcggcgcgcgctactgcctgtgcaccgcgctggatgaagcc
gccgccctcaccccttggggcagcaacagcgtctggtcgggcagcggcctgctggtcacc
ttccataacgagacctggggcggcgaaaagtttttccaactgctggccaagctgtcgcag
agcccacgcgagcacattaacctgctggagctggtcaactactgcctgctgctgggcttt
gaaggccgctaccgggtgatggaaaacggccgttcgcagctggaaaccatgaaacagcgc
ctgctgcagctgattcgctcggtgcgcggtggctatgctccgccgctgtcgccgaacgcg
gtcgatctgccggtgcagcaaaaactgtggcgaccgctggtgccgctgtgggcctgcgcg
gcgctgaccggtttcctcgcctcgctgctgtttatcgtactgaactggcgtctgggcgat
gccaccagcccggtgctggcctccatctaccagaccaacctgccgcaggtgacgatcggc
aacccggcgccggccgcgccgccggtgctgagcctgaaaagcttcctgcgtaaggagatc
gccgaaggcctggtcgtagtgcgcgatgaagcgcagcaaagcgtggtgatcctcaaaggc
gatggactgttcaactctgccgccaccagcgtacgcccggcgtatatcccggtcatcgac
cgcatcgccaaggcaatgaacggcgtcagcggcaaaatcctggtgaccggctatagcgac
agccagccgatccgcagcgcccgtttcgcctcgaactgggaactttcgctggcgcgcgca
gaagccgtcagcgaacggctgcaaaaacatcttgataaccctcagcgggtgaaagcggaa
ggccgcggcgaaagcaacccggtcgcgccgaacaacagtaaagagaaccgcgcattgaac
cgccgggttgaaattacgctgttggttgcgccagagaatactcaggcggaaatcaacgga
ctgcagcaaggaaacggaaagtaa

DBGET integrated database retrieval system