KEGG   Serratia sp. MYb239: CLM71_14300
Entry
CLM71_14300       CDS       T05477                                 

Definition
(GenBank) type VI secretion system protein TssA
  KO
K11902  type VI secretion system protein ImpA
Organism
serm  Serratia sp. MYb239
Brite
KEGG Orthology (KO) [BR:serm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:serm02044]
    CLM71_14300
Secretion system [BR:serm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CLM71_14300
SSDB
Motif
Pfam: ImpA_N Nitr_red_assoc
Other DBs
NCBI-ProteinID: AVJ18224
UniProt: A0A2R3H2Y9
LinkDB
Position
2977331..2978356
AA seq 341 aa
MAIETLLTPINADSPCGDNLEYDADFLAMEQACAGKAEQQFGDTIIPAEAPDWVQVERLA
TALLERTKDLRVMLPLTRAWTQLRGLQGYADGLTLIHQALDRYWEPLLPQLEFDGEADPL
FRINVLADLGDKSALAGCVRSAWLLKSAAGEIMLRDACSLLDGSKQECPTFPGGRARLQD
ELGQPEQPAVALVRTILLQLAAIRDIVTRHLGESALPEMHTLLKMFNVIAQAGGTTAPDV
ATPEAHDEQQPEQPASAQPAAAAALNWRSAQIQSRDDAQLMLEKVKSYFQLNEPSHPAPL
MIDRVQRLIALDFMQIVRDLAPDGLNQLETILGRTDNDDNH
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggctatcgaaaccctgctgaccccgattaacgcggattctccctgcggcgacaatctg
gaatatgacgctgactttttagcgatggagcaggcctgtgccggcaaggctgagcagcag
ttcggcgacaccattattccggctgaagcgccggattgggtgcaggtggagcgcctggcg
accgcactgctggaacgcaccaaggatctgcgggtaatgctgccgctgacgcgcgcctgg
acacagctgcgcggcctgcaaggctatgccgacggcctgacgctgattcatcaggcgctg
gatcgctactgggaaccgttgctgccgcagctggaatttgacggcgaagccgacccgctg
ttccgcattaacgtgctggcggatctcggcgacaagtccgccctggccggctgtgtacga
tccgcctggctgctgaaaagcgccgccggcgagattatgctgcgcgacgcctgctcgctg
ctggatggcagcaagcaggagtgccctaccttccccggcggccgcgcccgcctgcaggat
gagctgggccagccggaacagccggcggtggcactggtgcgcactatccttctgcaactg
gccgccattcgcgacatcgtgacgcgccacttgggcgaaagcgcgctgccggaaatgcac
accctgctgaaaatgttcaacgtgattgcgcaggccggcggcaccacggcgccggacgtc
gcaacgccggaagcacacgacgagcagcaacccgagcagcccgccagcgcccaaccggcc
gcagcggcggcgctcaactggcgcagcgcgcagattcagtcgcgcgacgatgcccaactg
atgctggaaaaagtaaaaagctattttcagctgaatgaaccgagccatccggcgccgctg
atgattgaccgcgtgcagcgcctgatcgctctggactttatgcaaatcgtccgcgacctg
gcgcccgatggtcttaaccaactggaaaccattcttgggcgcactgataacgacgacaac
cactga

DBGET integrated database retrieval system