KEGG   Serratia sp. MYb239: CLM71_16725Help
Entry
CLM71_16725       CDS       T05477                                 

Gene name
fadJ
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
serm  Serratia sp. MYb239
Pathway
serm00071  Fatty acid degradation
serm00280  Valine, leucine and isoleucine degradation
serm00281  Geraniol degradation
serm00310  Lysine degradation
serm00362  Benzoate degradation
serm00380  Tryptophan metabolism
serm00410  beta-Alanine metabolism
serm00640  Propanoate metabolism
serm00650  Butanoate metabolism
serm00903  Limonene and pinene degradation
serm00930  Caprolactam degradation
serm01100  Metabolic pathways
serm01110  Biosynthesis of secondary metabolites
serm01120  Microbial metabolism in diverse environments
serm01130  Biosynthesis of antibiotics
serm01200  Carbon metabolism
serm01212  Fatty acid metabolism
Module
serm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CLM71_16725 (fadJ)
   00650 Butanoate metabolism
    CLM71_16725 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLM71_16725 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLM71_16725 (fadJ)
   00310 Lysine degradation
    CLM71_16725 (fadJ)
   00380 Tryptophan metabolism
    CLM71_16725 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLM71_16725 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CLM71_16725 (fadJ)
   00281 Geraniol degradation
    CLM71_16725 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLM71_16725 (fadJ)
   00930 Caprolactam degradation
    CLM71_16725 (fadJ)
Enzymes [BR:serm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CLM71_16725 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CLM71_16725 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CLM71_16725 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AVJ18653
UniProt: A0A2R3H3W3
LinkDB All DBs
Position
complement(3486476..3488638)
Genome map
AA seq 720 aa AA seqDB search
MSAATNALHEQRAPQTAFRLTLRPDNIGVITIDVPGEKVNTLKAEFVEQINDVLIQAQQQ
TTLEGLVIISGKPDSFIAGADITMIAACNSAKEAQSLAKKGQSTLAQLAAFPVPVVAAIH
GACLGGGLELALACHSRVCSLDDKTALGLPEVQLGLLPGSGGTQRLPRLIGAGKALDMML
TGKQIRARQALRMGLVDDAVPHAILLETAVARARQGWSARRELPWQERLLNGPLGRSALF
AIVRKKTLEKTHGNYPAAERIIQVVRTGLDQGSASGYEAEARAFGELAMTPQSAALRSLF
FASTALKKERGADAQPHALERVGILGGGLMGGGIACVTATRGGLPVRIKDISTQGINHAL
KYSWDVLGKRVRRKRMRPAERQKQMMLISGTTDYCGFEQVDIVVEAVFEDLALKQQMVAE
IEQHAASHTVFASNTSSLPISQIAAKAQRPEQVIGLHYFSPVDKMPLVEVIPHAATSAAT
IATTVALAHKQGKTAIVVADRAGFYVNRILAPYINEAARCLLAGEPIEALDKALVDFGFP
VGPITLLDEVGIDVGTKIIPILVEELGSRFAAPAAFDAVLKDGRKGRKNGKGFYLYPSEG
QQRQRRKRADASVYTLLGVTPKAHLPPAEIAQRCVMMMLNEAARCLEEGVIRSARDGDIG
AVFGIGFPPFLGGPFRYMDELGAETVVKTLQYLQQQHGEHFAPCERLQRMAQQGERFYPR
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagcgaccaatgcactgcatgagcaacgggctccacagacggcgtttcgtctg
accctgcggccggacaacatcggcgtgattaccatcgacgtgccgggggaaaaggttaat
acgctgaaggcggagtttgttgaacagattaatgatgtgctgatccaggcgcagcagcag
accacgctggaaggcctggtcattatctccggtaagcccgattcctttatcgccggcgcc
gatatcaccatgatcgccgcctgcaacagcgccaaagaggcgcagtcgctggcgaagaaa
gggcagagcacgctggcgcagctggcggcttttccggtgccggtggtggcggcgatccac
ggtgcctgtctgggcggcgggcttgagctggcgctggcttgccacagccgggtatgttcc
ctggacgataaaaccgcgctcggcctgccggaagtgcagctggggctgttgccgggatcc
ggcggcacgcagcggctgccgcgtctgattggcgccggcaaagcgctggatatgatgctg
accggcaaacagatccgcgctcgtcaggcgctgcgcatggggctggtggacgatgcggtg
ccgcacgccattttgcttgagacggcggtcgcgcgcgccaggcagggctggtcggcgcgg
cgcgagctgccgtggcaggagcggttgctcaacggcccgctcgggcgcagtgcgctgttc
gccatcgtgcgcaagaaaacgctggagaagacgcacggcaattatccggcggcggagcgg
attatccaggtggtgcgtaccggtttggaccagggcagcgccagcggttatgaggccgag
gcgcgcgcttttggcgagctggcgatgacgccgcagtcagcggcgctgcgcagcctgttt
tttgcttccaccgcgctgaaaaaggagcgtggcgccgatgcgcagccgcacgcgcttgaa
cgggttggtattctgggcggcggcctgatgggcggcggcattgcctgtgtgacggctacg
cgcggcggtttgccggtacgtattaaggacatcagcacccagggcattaatcacgcgctg
aaatacagctgggacgtgctgggcaagcgggtgcgccgtaagcgtatgcgtccggcggag
cggcaaaagcagatgatgctgatttccggcaccaccgattactgcggtttcgagcaggtg
gacatcgtggtggaggcggtgttcgaagatctggcgctgaagcagcagatggtggcggag
atagagcagcacgccgcgtcgcataccgtctttgcctctaacacctcttcgctgccgatt
agccagatcgccgccaaggcgcagcggccggagcaggtgatcgggctgcactatttcagc
ccggtggacaaaatgccgctggtggaggtgataccgcatgccgcaaccagcgccgcaacc
atcgccactaccgtagcgttggcgcataagcaggggaaaacggcgatagtggtggccgac
cgcgccggtttttacgttaaccgcatcctggcgccctatattaatgaggcggcgcgctgt
ctgctggccggcgagccgatcgaggcgctggataaggcgctggtggatttcggcttcccg
gtggggccgattacactgttggacgaggtcggtatcgacgtcggcaccaaaattattcct
attctggtggaagaactggggtcgcgcttcgccgcgccggcggcgtttgatgcggtgctg
aaagatggccgcaaagggcgcaagaacggcaagggcttctatctgtatcccagcgaaggc
cagcagcgccagcgccgaaaacgtgctgacgcttcggtttatacgctgctcggcgtcacg
ccgaaggcgcatctgccgccggcggagatcgcccagcgctgcgtgatgatgatgctgaac
gaagcggcgcgttgtctggaagaaggcgtgattcgcagcgcccgcgacggcgatatcggc
gcggtgttcggcattggcttcccgccgttcctcggcggaccattccgctatatggatgag
cttggtgcggagacggtggtgaaaaccctgcaatatctgcagcagcagcacggcgagcat
tttgcgccgtgcgaacgtctgcagcgcatggcacaacagggcgagcgtttctatccccgc
tag

DBGET integrated database retrieval system