KEGG   Serratia sp. MYb239: CLM71_17200Help
Entry
CLM71_17200       CDS       T05477                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
serm  Serratia sp. MYb239
Brite
KEGG Orthology (KO) [BR:serm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CLM71_17200
Enzymes [BR:serm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     CLM71_17200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AVJ18740
UniProt: A0A2R3H4A5
LinkDB All DBs
Position
complement(3584418..3585530)
Genome map
AA seq 370 aa AA seqDB search
MCQTCVTAAKMADGIPETMKAIVAYAPKDYRLEEVAVPKIGPKEILVKIEACGICAGDIK
AFEGAPSFWGDETQPAYIKAPMIPGHEFIGHVVGYGEGVEGFDIGDRVISEQIVPCWQCR
FCNRGQYWMCEKHDLYGFQKNVNGGMAEYMKFTKEAINYHVPADLPIEKAILIEPYACSF
HAVQRANIKLGDVVVLAGAGTLGLGMIGAIKKSGPSKLIVLDLSDERLALAKTFGADLTL
NPTRDDVPAVIKQLTDGYGCDIYIEATGAQKSVEQGLTLIRKLGTFVEFSVFKDPVTVDW
SIISDRKELDVLGSHLGPYCYPLVIEGIGNGDLPTEGVVTHTLPLEQFAEGFELMKRGIG
SIKVVLNPNL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcagacctgtgtaacagcggcaaaaatggcggacggcatcccagaaaccatgaag
gcgatcgttgcctacgcgcccaaggattaccgtctggaagaggtagcggtgccgaagatc
ggcccgaaagagatcctggtgaagatcgaggcctgcggcatctgcgccggcgatatcaag
gcgtttgaaggggcgccgagcttctggggcgatgagacgcagccggcctatatcaaggcg
ccgatgatcccgggccatgaatttatcggccatgtggttggctacggcgagggcgtggaa
ggatttgatatcggtgaccgggtgatctcggaacagatcgtgccctgctggcagtgccgt
ttctgcaaccgaggccagtactggatgtgtgaaaaacacgatctgtacggctttcagaag
aacgtcaacggcggcatggccgagtacatgaagttcaccaaagaggcgattaactaccac
gtgccggcggatctgccgattgaaaaagccattctgatcgaaccttacgcctgctcgttc
catgcggtgcagcgcgccaatatcaaactgggggacgtggtggtgctggccggggccggc
acgctggggctggggatgatcggcgcgatcaaaaaatccggaccgtcgaagctgatcgtg
ctcgatctgtcggatgagcggctggcgctggcgaagaccttcggcgcggatctgacgctc
aaccctacccgtgacgacgtaccggcggtcatcaagcagctgaccgacggctacggctgc
gatatctacattgaagccaccggtgcgcagaagtcggtggagcaggggctgacgctgatc
cgcaagctcggcacctttgtggagttctcggtgttcaaggatccggtgaccgtcgactgg
agcatcatcagcgaccgcaaagagctggatgtgctcggctcacaccttggcccgtactgc
tatccgctggtgattgagggcattggcaacggcgatttgccgaccgaaggcgtggtgacc
cacaccctgccgctggagcagtttgccgaaggcttcgagctgatgaaacgcggcatcggg
tcgatcaaagtggtgcttaatccaaatctgtaa

DBGET integrated database retrieval system