KEGG   Serratia sp. MYb239: CLM71_22415Help
Entry
CLM71_22415       CDS       T05477                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
serm  Serratia sp. MYb239
Pathway
serm00564  Glycerophospholipid metabolism
serm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CLM71_22415
Enzymes [BR:serm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CLM71_22415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AVJ19704
UniProt: A0A2R3H760
LinkDB All DBs
Position
4689627..4691135
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPGS
KSLRFGPESVLKPELKRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWRENG
MWMVEATDIDSGKTFTWRAKGLVNATGPWVKNFFDDGLKLKSPYGIRLIKGSHIVVPKAH
NQPQSYILQNEDNRIVFVIPWMDEFSIIGTTDVEYHGDPKDVKIDDNEINYLLKVYNDHF
KKQYGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDDNGQAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPEAGPAWTKNGTLPGGDIGGDRDSYAAKLRREHGWLPEALARRYART
YGSHSELILSGANSLADLGEDFGHGLYEAELRYLVEKEWVVELKDAIWRRTKLGMWLDEA
QQARVSEWLAERAKAKALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggcggcatcaacggtgccggcatcgcggcg
gatgctgccgggcgcggcctgtccgtactgctactggaagcgcaagacttggcctgtgct
acgtcttccgccagttccaaactgatccacggcggcctgcgctacctggaacactatgaa
ttccgtctggtgagcgaagcgctggctgaacgtgaggtgctgctgaaactggcgccgcat
atcgccttcccaatgcgcttccgcctgccgcaccagccacacctgcgtccggcctggatg
atccgtaccggcctgttcctgtacgatcacctgggtaaacgcaccagcctgccgggcagc
aagagtttgcgttttggcccagaatccgtactgaagccggaactgaagcgcggtttcgaa
tattccgactgctgggtcgacgatgcgcgtctggtggtattgaacgcgcaggaagtggtg
gaacgcggcggcgaagtgcgcacccgcaccaaagtgacccgcgcatggcgtgagaacggc
atgtggatggtggaagcgaccgatatcgacagcggtaaaaccttcacctggcgcgccaaa
ggcctggttaacgctaccggcccgtgggtgaaaaacttcttcgatgacggcctcaagctg
aaatcaccctatggcatccgcctgatcaaaggcagccatatcgtggtgccgaaggcgcat
aaccagccgcagtcctacattctgcagaacgaagacaaccgtatcgtctttgtgatcccg
tggatggatgagttctcgattatcggcaccaccgatgtggaatatcacggcgatccgaaa
gacgtgaagattgacgataacgaaatcaactacctgctgaaagtgtataacgaccacttt
aagaaacagtacggccgtgacgatatcgtctggacctactccggcgtacgtccgctgtgc
gacgatgagtccgattcaccgcaggccatcacccgtgattacacgttggacgtgcatgac
gataacggccaggcgccgctgctgtcggtcttcggcggtaagctgaccacctatcgcaag
ctggcagaacacgcgatggaaaaactggcgcactattatccggaagccggcccggcctgg
accaagaacggcaccctgccgggtggcgacatcggcggcgaccgcgacagctacgcagcc
aaactgcgccgtgaacacggctggttgccggaagcgctggcgcgccgctatgcccgtacc
tacggcagccacagcgaactgattctgtccggcgccaacagcctggcggatctgggcgaa
gacttcggccacggcctgtacgaagcggagctgcgctacctggtggagaaagagtgggtg
gtggagctgaaagacgccatctggcgccgcaccaaactcggcatgtggctggacgaagcg
caacaggcgcgcgtcagcgagtggctggcggaacgcgcaaaagccaaagcgctgtcgctg
gcttcctaa

DBGET integrated database retrieval system