KEGG   Serratia sp. ATCC 39006: CWC46_01675
Entry
CWC46_01675       CDS       T05968                                 

Definition
(GenBank) glutathione-disulfide reductase
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
serq  Serratia sp. ATCC 39006
Pathway
serq00480  Glutathione metabolism
serq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CWC46_01675
Enzymes [BR:serq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     CWC46_01675
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 Pyr_redox K_oxygenase FAD_oxidored AlaDh_PNT_C 2-Hacid_dh_C GIDA
Other DBs
NCBI-ProteinID: AUG98646
UniProt: A0A2I5T234
LinkDB
Position
complement(362230..363579)
AA seq 449 aa
MTKHYDYLSIGGGSGGIASINRAAMYGKKCALIEAKYLGGTCVNVGCVPKKIMWHAAQIA
EAIHQYGPDYGFDVTVNHFNWDRLLKNRSAYIDRIHQSYDNVLGKNSVDVIQGFARFVDA
HTVEVNGERITAEHILIATGGRPTHPNIPGVEYGIDSDGFFELQALPKRVAVVGAGYIAV
EIAGVLNALGAETHLFVRKHAPLRQFDPLIVDTLLEVMNTEGPTLYTESIPKAVVKNADD
SLTLQLENGAEHTVDCLIWAIGREPATDKLNLAAAGVALDEQGYIAVDKFQNTNVQNIYA
VGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHLDYTNVPTVVFSHPPIGTVGLTEPQAR
QQYGDQVKVYTSSFTAMYTAVTQHRQPCRMKLVCVGPEEKIVGIHGIGFGMDEMLQGFAV
AVKMGATKQDFDNTVAIHPTASEEFVTMR
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgactaaacattacgactacctttccattggcggcggcagtggcggtattgcttcgatt
aaccgtgcggccatgtatgggaagaaatgtgcgttgattgaagcgaaatatctgggcggc
acctgcgttaatgtcgggtgtgtgccgaagaaaatcatgtggcatgctgcgcagatagca
gaagcgattcatcagtatggcccggattacggttttgacgtgacggtgaatcatttcaac
tgggataggttgcttaaaaatcgtagtgcttatatcgaccggattcatcagtcttacgac
aatgtgctgggtaaaaatagcgttgatgtgattcaggggttcgcccgctttgtggatgca
cacaccgtagaagtaaatggtgagcgcatcaccgccgagcatattttaatcgcgaccggt
ggacgtcctacccatccgaatattcccggcgtggaatatggtatcgattcggatggtttc
tttgagctacaagcgctgccgaaacgcgtagcggtggtgggtgctggttatatcgcggta
gaaattgccggtgtgttgaatgcactgggtgcagaaacacacctgtttgtacgtaagcac
gcgccgttgcgtcaatttgatccgctgattgttgatacattgctggaagtgatgaacacc
gaaggcccgacgctgtataccgaatcgattcccaaagcggtggtgaaaaacgcggatgac
agcctgacgctacagttggaaaatggcgcagaacatacagtggattgcctgatctgggcg
attggccgtgagccagctaccgataagctgaatctggcggcggcgggtgttgcgctggat
gaacagggctacatcgcggtggataagttccagaataccaatgtgcagaacatctatgcc
gtaggtgacaatactggcgcggtggaactgacgccagtggctgttgccgcaggtcgtcgt
ctctctgaacgtctgtttaacaacaaaccggacgagcatctggattacaccaatgttccg
actgtggtgttcagtcatccgccgattggtaccgtaggcctgaccgagcctcaggcgcgc
cagcagtatggcgatcaggtgaaagtgtacacatcatcgtttacggcgatgtataccgcc
gtgacccaacaccgccagccatgtcgtatgaaactggtatgtgtggggccggaagagaag
attgtcggcatacatggtatcggctttggcatggatgaaatgctgcaaggttttgcggtg
gcggtgaaaatgggcgctaccaaacaggatttcgataacaccgtagcgattcacccgacg
gcatcagaagagttcgttactatgaggtga

DBGET integrated database retrieval system