KEGG   Serratia sp. ATCC 39006: CWC46_05220
Entry
CWC46_05220       CDS       T05968                                 

Definition
(GenBank) fumarate reductase flavoprotein subunit
  KO
K00244  fumarate reductase flavoprotein subunit [EC:1.3.5.4]
Organism
serq  Serratia sp. ATCC 39006
Pathway
serq00020  Citrate cycle (TCA cycle)
serq00190  Oxidative phosphorylation
serq00620  Pyruvate metabolism
serq00650  Butanoate metabolism
serq01100  Metabolic pathways
serq01110  Biosynthesis of secondary metabolites
serq01120  Microbial metabolism in diverse environments
serq01200  Carbon metabolism
serq02020  Two-component system
Module
serq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
serq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
serq_M00150  Fumarate reductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:serq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CWC46_05220
   00620 Pyruvate metabolism
    CWC46_05220
   00650 Butanoate metabolism
    CWC46_05220
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CWC46_05220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CWC46_05220
Enzymes [BR:serq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     CWC46_05220
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 HI0933_like DAO GIDA Lycopene_cycl FAD_oxidored
Other DBs
NCBI-ProteinID: AUG99268
UniProt: A0A2I5T3W6
LinkDB
Position
complement(1114703..1116499)
AA seq 598 aa
MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSHTVAAEGGSAAVTQDH
DSFDFHFHDTVAGGDWLCEQDVVDQFVQSCPREMTQLEQWGCPWSRKPDGSVNVRRFGGM
KIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILVDDGQARGLVAINMMEGT
LVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAFRHGVPLRDMEFVQYHPTGLPGS
GILMTEGCRGEGGIMVNKDGYRYLQDYGMGPETPLGQPKNKYMELGPRDKVSQAFWHEWR
AGRTISTPLGDVVYLDLRHLGEKKLKERLPFICELAQAYVGVDPVKEPIPIRPTAHYTMG
GIETDQQCETRIKGLFAAGECSSVGLHGANRLGSNSLAELVVFGRIAGEHATQRSLESAP
ANASALDAQARDVEQRLHTLMKQEGTESWAKIRDEMGISMEEGCGIYRTTELMQKTLDKL
AELKERFKRVKITDHSSVFNTDLLYTIELGHSLDVAQCMAHSAINRKESRGAHQRLDEGC
TERDDVNFLKHTLAFYNPEGAPRLEYSDVKITKLPPAKRVYGGEADAQEKSDKEQANG
NT seq 1797 nt   +upstreamnt  +downstreamnt
ttgcaaacctttaatgccgacttggccattatcggggccgggggcgctggtttacgagcg
gcaattgctgccgccgaagctaatccccaactgaagattgctctgatctctaaagtttat
cccatgcgtagccatactgtggctgccgaagggggatcagcagcagtcactcaggatcac
gatagctttgatttccattttcacgataccgtcgcaggtggtgactggttgtgcgaacag
gatgttgtcgaccagttcgtacaaagttgtccacgtgaaatgacccaactggagcaatgg
ggctgcccctggagccgcaaaccggatggttctgtcaacgtgcgccgttttgggggaatg
aagattgagcgtacctggttcgccgctgacaaaaccggcttccatatgctacatacgttg
ttccagacgtccctgaaatacccgcagattcagcgctttgacgaacatttcgtgctggat
attctggtagatgacggacaggctcgcgggcttgtcgccatcaatatgatggaaggcaca
ctggttcagatccgcgccaacgccgtgattatggccaccggtggcgctggccgtgtttac
cgttataacaccaacggcggtatcgtcaccggtgacggtatgggcatggcattccgtcac
ggcgttccactgcgtgatatggagttcgtccagtaccatccaacaggtctgccaggctcc
ggcatcctgatgacggaaggctgccgtggtgaaggcggtatcatggtcaacaaagatggc
taccgttacctacaggattacggtatggggccggaaacgccgctgggtcagccgaaaaat
aaatacatggaactgggaccgcgtgacaaagtatcgcaggccttctggcatgaatggcgt
gccggtcgcaccatttccaccccgctgggtgatgtggtttaccttgacctgcgtcatctg
ggtgaaaagaaactgaaagagcgtctgccgttcatctgtgaattggctcaggcttatgtc
ggtgtcgacccggtgaaagagcccattccaattcgtccgaccgcacactacaccatgggc
ggcatcgaaacagaccagcagtgtgaaacccgaatcaaggggttgtttgccgccggtgaa
tgctcctctgtcggtctgcatggtgccaaccgtctgggctccaactccctggcagaactc
gtcgtatttggtcgtatcgctggcgaacatgccacccagcgctctctggaatcggccccg
gccaacgccagtgcgttggatgcacaggctcgcgatgtagaacagcgtctgcataccctg
atgaaacaggaaggcacagagagctgggcgaagatccgcgacgaaatgggtatatcgatg
gaagaaggttgcggtatctaccgtactaccgagttaatgcaaaaaacgctggataagctg
gctgagctgaaagaacgcttcaaacgcgtgaagattaccgaccattccagcgtattcaat
accgacctgctttataccatcgaactgggacacagcctggacgtcgcgcaatgtatggcg
cactccgctatcaaccgtaaagaatcccgtggtgcgcaccagcgtctggatgaaggctgc
accgaacgtgatgatgtgaatttcctgaaacacacactggcgttctacaacccggaaggc
gcacctcgtctggagtacagtgatgtgaagatcaccaaactaccgccggcaaaacgtgtg
tacgggggcgaggctgacgctcaggaaaaaagtgataaggagcaagcgaatggctga

DBGET integrated database retrieval system