KEGG   Serratia sp. ATCC 39006: CWC46_05270Help
Entry
CWC46_05270       CDS       T05968                                 

Definition
(GenBank) galactonate oxidoreductase
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
serq  Serratia sp. ATCC 39006
Pathway
serq00053  Ascorbate and aldarate metabolism
serq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    CWC46_05270
Enzymes [BR:serq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     CWC46_05270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 3HCDH_N Pyr_redox_3 Pyr_redox_2 Sacchrp_dh_NADP Pyr_redox XdhC_C FAD_binding_3 HI0933_like NAD_binding_8 adh_short
Motif
Other DBs
NCBI-ProteinID: AUG99276
UniProt: A0A2I5T3X8
LinkDB All DBs
Position
1127489..1128511
Genome map
AA seq 340 aa AA seqDB search
MVMMKSLVCLEPENMLFQQRNKPIPADNEVLIKIKTVGICGTDIHAWAGKQPFFSYPRVL
GHEICGEVVGLGNNIHDIRIGKQVVVIPYVACKKCPACLSGRTNCCENISVIGVHQDGGF
SEYLSVPVTNILLAEGIDPESAALIEPFAISAHAVCRAEIKPEEPVLVVGAGPIGLGVAA
IAKADGAHVLVADTSAERRTHVQRYLQLEALDPAQADFDAQLREKFSGSLAQKVIDATGN
PLAMNNTVNLIRHGGSIIFVGLFKGELQFSDPEFHKKETTIMGSRNATLDDFAKVGRLMV
EGKLRAEMMLTHRYRFDVLADVYEKDVINNRDLIKGVIHF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggttatgatgaaatcattggtgtgtttagaaccagaaaatatgcttttccagcagcgt
aataagcccattccggcagataatgaggtgttgataaaaataaagacagtgggaatttgt
ggtacggatattcatgcctgggcggggaaacaaccttttttcagttatccacgggtgtta
ggccatgaaatatgtggggaggtggtcggtcttggcaataatattcatgatatacgaatc
ggaaaacaggtcgtagttatcccctatgtggcctgtaaaaaatgcccggcttgcttgagt
gggcgtactaattgctgcgaaaatatttcagtgattggtgtacatcaggatggtggattt
agtgaatatctgagtgtaccggtgactaatattttattggcggaggggattgatcctgaa
tctgcggcattgattgagccatttgctatcagtgctcatgctgtttgtcgggcagagatc
aaacccgaagagccggtgctggtggtgggggccgggcctatcgggttgggtgtggcggcg
atagccaaggcggacggcgctcatgtgttggttgcagataccagtgcggaacgacgtact
catgtacaacggtatctacagcttgaagcattggatcctgcgcaggcagattttgatgcg
cagttgcgtgagaaattcagtggctcgctggcgcagaaggtgatcgacgccaccggcaat
ccgctggcgatgaataacaccgttaatttgattcgtcacggcggcagcatcattttcgtc
ggactgtttaaaggggaattgcagttttctgatcctgaattccataagaaagagaccacc
ataatgggaagccgtaatgcaaccctggacgactttgccaaagtggggcgcttaatggtt
gagggcaagctcagggccgagatgatgttgacccaccgttaccgttttgatgtgctggcc
gatgtttatgaaaaggatgtgattaataaccgcgatctgatcaaaggcgtcattcatttc
tga

DBGET integrated database retrieval system