KEGG   Serratia sp. ATCC 39006: CWC46_12355Help
Entry
CWC46_12355       CDS       T05968                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
serq  Serratia sp. ATCC 39006
Brite
KEGG Orthology (KO) [BR:serq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:serq03016]
    CWC46_12355
Enzymes [BR:serq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     CWC46_12355
Transfer RNA biogenesis [BR:serq03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    CWC46_12355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2
Motif
Other DBs
NCBI-ProteinID: AUH00533
UniProt: A0A2I5T7I3
LinkDB All DBs
Position
complement(2733853..2735784)
Genome map
AA seq 643 aa AA seqDB search
MFQDNPLLAQLKQQLHSQTPRVEGVVKATDKGFGFLEADAQKSYFIPPPQMKKVMHGDRI
VATVHTEKERESVEPESLVEPFLTRFVGRVQKKDDRLAIIPDHPLLKESISCHTAHALAH
DFQEGDWAVAEMRRHPLKGDRNFHAELTQYITNSEDPLVPWWVTLSRHDLERTAPEADTA
ALDDGDLQREDLTALDFVTIDSASTEDMDDALFVQDNDDGSLQLTVAIADPTAYVPAGSE
LDAIARHRAFTNYLPGFNIPMLPRHLSDDICSLRPGERRPVLACRMTIADDGTLDDMHFF
AAWIESKAKLAYDSVSDWLEQQGDWQPASETITHQLRLLQRVCLARSHWRTTHALVFKDH
PDYRFLLGDKGEVLDIVVEHRRIANRIVEEAMIAANVCAAQVLRDKLGFGIYNVHNGFDP
SKVEQAVTVLGNNGIHADAQHLLTLEGFCALRRELDTQPTQFLDSRIRRFQSFAEVSTTP
GPHFGLGLEAYATWTSPIRKYGDMVNHRLLKAIISGQPTEKPQDDVTVKLSERRRLNRMA
ERDVSDWLYARFLKEKAGTDARFLAEIMDVTRGGLRVRLLDNGASAFIPASFIHAVRDEL
ACSQETGTVTVKGETVYRQSDTLEVTIAEVRLDTRNIIAKPAA
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaagataatccgctgcttgctcagcttaaacagcaactccattcccaaacgcca
cgggtagaaggcgtcgttaaagctaccgataagggattcggctttcttgaagccgacgct
caaaagagttatttcattccgccaccgcaaatgaagaaagtcatgcacggtgaccgtatt
gtcgccacagtgcatacggaaaaagagcgagaaagcgtcgaaccagaatcgttagttgag
ccgttcctgacccgctttgtcgggcgtgttcagaagaaagacgatcgtctggctattatt
cctgaccatccgctactgaaagaatccatctcttgccacaccgcacacgcgttggcgcat
gactttcaggagggcgactgggctgtagcggaaatgcgccggcacccgctgaaaggtgat
cgcaacttccacgctgaactaacgcagtacattactaacagtgaggatcctctggtccca
tggtgggtgacattgtcacgtcacgatctggagcgcactgcccccgaagccgatactgcc
gcactggatgacggagatttgcagcgagaagacttaaccgcgctggattttgtcactatc
gacagtgccagtacggaagatatggacgatgccttgttcgtacaggataacgatgatggt
tcactgcaactgacggtggcaattgccgaccctaccgcgtatgtccctgctggcagtgaa
ctggatgccattgcgcgtcatcgcgcgtttaccaattatttgcctggtttcaatatcccg
atgctcccgcgccatttatcggatgatatctgttcactacggccaggagaacgtcgccca
gtactggcatgtcgcatgactatcgccgacgacggaacgctggatgacatgcacttcttc
gccgcctggattgagtccaaagccaagctggcctatgacagtgtttctgattggctggaa
caacaaggtgactggcaacctgccagcgagacaattacccatcagctccgtctgctacaa
cgcgtatgcctggcccgcagtcactggcgcacgacacatgctctggtattcaaagatcac
ccagattaccgtttcttattgggagacaaaggtgaagtgctggatatcgtggtagagcac
cgtcgcattgccaaccgtattgtggaagaagcgatgattgccgctaacgtttgtgcggcg
caggttctacgtgacaagcttggttttggcatttacaacgtacataatggctttgacccg
tccaaggtggaacaagcggtcaccgtgctgggaaataatggtattcatgccgatgcgcaa
catctgctgacattagagggtttttgtgcgttgcgccgtgaactggatactcagccaaca
caattccttgacagtcgtatccgtcgttttcagtcatttgcggaagtcagcaccacgcct
gggccgcattttggtcttggtctggaagcttatgccacctggacttcgccaatccgtaag
tacggagatatggtgaatcatcgcctgctgaaagcaattattagtggtcagccgacagaa
aaaccacaggatgacgttactgtgaagttgtcagaacgccgtcgtttgaatcgtatggct
gaacgtgatgtcagtgactggttgtatgcccgttttctaaaagaaaaagcaggcactgac
gcacgttttctggcagaaatcatggacgtgactcgcggcggtctgcgtgttcgtttactg
gataacggtgcctcggcatttattcctgcatcatttattcatgcggtacgtgatgaactg
gcatgcagccaggaaaccggtaccgtgacggtgaaaggtgaaacggtatatcgccaaagt
gatacgctggaagtgaccattgctgaagttcgtctggatactcgcaacattatcgccaaa
ccagcagcttaa

DBGET integrated database retrieval system