KEGG   Serratia sp. ATCC 39006: CWC46_15445
Entry
CWC46_15445       CDS       T05968                                 

Definition
(GenBank) glutamate synthase
Organism
serq  Serratia sp. ATCC 39006
SSDB
Motif
Pfam: Pyr_redox_2 Fer4_20 Pyr_redox_3 Pyr_redox NAD_binding_8 Fer4 AlaDh_PNT_C FAD_oxidored DAO Fer4_10 Fer4_21 HI0933_like Fer4_7 Fer4_2 Amino_oxidase Fer4_9 FAD_binding_2 Fer4_6 GIDA Fer4_4 Thi4 NAD_binding_9 FAD_binding_3 Oxidored_nitro AdoHcyase_NAD Fer4_16
Other DBs
NCBI-ProteinID: AUH01087
UniProt: A0A2I5TLF9
LinkDB
Position
3377203..3378849
AA seq 548 aa
MKKSTNDMTQPPDLRTKTGTGPIRRTHPVYQNSLPPCNQACPAGENIQEWLALAQEERYE
EAWQHLVANNPMPAVHGRVCYHPCENACNRAQVDQSVSIHAVERFLGDQALLHGWKTTFT
AVPSGKKVLVIGAGPSGLSCAWQLRRLGHEVEIHEAGPMAGGMMRFGIPAYRMPRDVLDQ
EIQHILDTGITLKLNQKVNDVLKVKTEYGFDAVFLAIGAHLAKRIDIPGRDAGRILDAVS
YLSAVEQGDVPKLGRRVAIYGGGNTAMDAARTAHRLGAEEAVIIYRRDREHMPAHQFEAD
EALEEGVIINWLRTIRDIDGTTLTIEEMEIDDNGRPQPTGRYETLEADSVILALGQDVDL
SVIARIPGIELHEDGVVVVDEHMMTSVPGIFAGGDMVPSERTVTVATGHGKKAAQHIDGW
LRHQPYRKADTNAGIPYSALNLWFDTDAESTSQPVVTPEQRDGFDEIIGGLTATQARYEA
ARCYSCGNCFECDGCYGSCPEDAILKLGKGRGYRIDYDKCTGCGACYDQCPCHAISMVSE
VVDNEYTF
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgaagaaatcgactaatgatatgacccagccgcctgatttacggactaaaacaggcacg
gggccgatccgacgtactcatcccgtttatcaaaattcactaccgccttgtaatcaggcc
tgtccggctggcgagaatattcaggagtggctggcgttggcacaggaagagcgctacgaa
gaggcctggcaacatttggtggccaataacccgatgcccgccgtgcatggccgggtttgc
taccatccttgtgaaaatgcctgtaatcgagcccaggtcgaccaatccgtcagtattcat
gccgtcgagcgttttctgggcgatcaggcgctactgcatggctggaaaaccacattcacc
gccgttccgagcggtaaaaaggtcctggtgatcggcgccggtccctcgggattatcctgt
gcctggcaactccgtcgcctcggccatgaggtggaaattcacgaggccggtccgatggct
ggcgggatgatgcgtttcggcatccctgcttaccgaatgccccgtgatgtgctggatcag
gagatccaacatatcctcgatacgggcattacgctgaagctcaatcagaaagtgaatgat
gtcctcaaggtaaaaaccgagtatggctttgatgccgtttttctggctatcggtgcgcat
ttagccaagagaatcgacattccagggcgtgatgccgggcgcattctggatgcggtcagt
tatctttcggcggttgaacaaggcgacgtgcccaaattgggtcgtcgtgtcgctatctat
ggtggcggcaatacggcgatggatgcagcgcgtaccgcgcatcgtctgggggcggaagaa
gcggttatcatctatcgacgagatcgtgaacatatgccggcgcatcagtttgaagccgat
gaagcattagaagagggcgtcatcattaactggctgcgcaccattcgggatattgatggt
acgacgttaaccattgaagagatggagattgacgacaacggacggccacagccaaccggc
cgatatgaaacgctggaagctgacagcgtgatcctggcgttgggacaagatgtggatctc
tcggttatcgcccgcattcccggcattgaattacatgaagatggcgtggtggtggttgac
gaacacatgatgaccagcgtgccgggtatttttgccggtggcgatatggtgccatcggaa
cgcaccgtcacggtcgccaccgggcatggcaagaaagcggcgcaacatattgatggctgg
ctacgtcatcaaccctaccgaaaagcagacactaacgccggcattccctattcagcattg
aatctgtggttcgacacggatgccgagtcaaccagccagccggttgtcaccccggaacag
cgcgatggatttgacgaaatcatcggcggactcaccgccacacaagcgcgttatgaagcg
gcccgctgctactcctgtggcaattgtttcgagtgtgatggctgttacggatcatgcccg
gaggacgccattctcaagttgggtaaaggacggggatatcgtattgattacgataaatgt
accggctgcggcgcgtgctatgaccaatgcccctgtcatgccattagcatggtaagtgag
gtggttgataatgaatacacattctga

DBGET integrated database retrieval system