KEGG   Serratia sp. ATCC 39006: CWC46_18710Help
Entry
CWC46_18710       CDS       T05968                                 

Definition
(GenBank) DNA topoisomerase (ATP-hydrolyzing) subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
serq  Serratia sp. ATCC 39006
Brite
KEGG Orthology (KO) [BR:serq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:serq03032]
    CWC46_18710
   03400 DNA repair and recombination proteins [BR:serq03400]
    CWC46_18710
Enzymes [BR:serq01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     CWC46_18710
DNA replication proteins [BR:serq03032]
 Prokaryotic type
  DNA Topoisomerases
   CWC46_18710
DNA repair and recombination proteins [BR:serq03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      CWC46_18710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: AUH01654
UniProt: A0A2I5TAS2
LinkDB All DBs
Position
complement(4110050..4112689)
Genome map
AA seq 879 aa AA seqDB search
MSDLAREITPVNIEDELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMSVLGNDWN
KPYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAM
RYTEVRMSKIAHELLADLEKDTVDFVPNYDGTEQIPDVMPTRIPNLLVNGSSGIAVGMAT
NIPPHNLSEVINGCLAYIDDEDISVEGLMAHIPGPDFPTSAIINGKRGIEEAYRTGRGKV
YIRARAEVEADAKSGRETIIVHEIPYQVNKARLIEKIAELVKDKRIEGISALRDESDKDG
MRIVIEIKRDGVGEVVLNHLYSQTQMQVSFGINMVALHQGRPKLMTLKDILSAFVRHRRE
VVTRRTIFELRKARERAHILEGLAIALVNIDPIIELIRHASTPAEAKAGLISKPWDLGTV
AAMLENAGDDAARPEWLEPEFGIHEGKYYLTEPQAQAILDLRLQKLTGLEHEKLLDEYKE
LLTQIAGLLYILQNPERLMEVIREELEAIKEQYNDPRRTEITHNTADINIEDLISQEDVV
VTLSHQGYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLY
WMKVYQLPEASRGARGRPIVNLLPLEPNERITAILPVREYEEGKSVFMATASGTVKKTAL
TGFSRPRSAGIIAVNLNDGDELIGVDLTDGSDEVMLFSAAGKVVRFSEGAVRCMGRTATG
VRGINLQGEDRVVSLIIPRGEGDILTVTQNGFGKRTAVIEYPVKSRATKGVISIKVSDRN
GKVVGAVQVDAADQIMMITDAGTLVRTRVSEVSIVGRNTQGVTLIRTADDENVVGLQRVA
EPVEDEELDGVVAVEGEVPEDEGNVDDIDNDDDIPEDDE
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccttgccagagaaattacaccggtcaacatcgaggacgagctgaaaagctca
tatctggattatgccatgtctgttattgtcgggcgtgcgttgccagatgttcgtgatggc
ctgaagccggtacatcgtcgcgtactgtttgcgatgagtgtactcgggaatgactggaat
aaaccttacaaaaaatcggcccgtgtggtcggggatgttatcggtaaatatcacccacat
ggtgatagcgcagtgtatgacactattgtgcgtatggcgcagccgttttcattacgttac
atgttggtagatggtcagggtaacttcggttccgttgacggcgattccgccgctgcaatg
cgttataccgaagttcgcatgtcgaaaattgcccatgaactgcttgccgatctggaaaaa
gataccgtcgattttgtaccgaactatgacggtacggagcagattcctgacgttatgcct
acccgcattccgaatctgctggtaaatggttcgtccggtattgcggtggggatggcgacc
aatattcctcctcataacctgtctgaagtgatcaacggttgcctggcctatattgacgat
gaagatatcagcgtcgaaggcctgatggcccatataccagggccggatttccctacgtct
gccatcattaacggcaagcgtggtattgaggaagcctaccgtaccggtcgtggcaaggtt
tatatccgtgctcgcgccgaggtagaagctgatgccaaaagtggtcgtgagacgatcatc
gtgcatgaaattccatatcaggtgaataaagcccgcctgattgagaaaatcgccgagctg
gtaaaagataagcgtattgagggaatcagcgcgctgcgtgacgagtcggataaagacggt
atgcgcatcgtgattgaaatcaagcgtgatggggtcggtgaggtggtgctgaaccatctg
tattcccagacgcagatgcaggtttcttttggtatcaatatggtcgccctgcatcaggga
agacctaagcttatgacgctgaaggatattttatctgcattcgtccgtcatcgtcgtgaa
gtggttacccgccgaactatctttgaattgcgtaaagcacgcgaacgggcccatatcctg
gaaggcctggcgattgctctggtgaatatcgatccgataatcgagttgattcgtcatgct
tcaacaccggcggaggccaaagcggggttgatttccaaaccttgggatttgggtaccgtt
gccgccatgctggaaaatgcgggggatgatgccgcacggccggaatggctggagccggaa
ttcggtattcatgaagggaaatattatctcaccgagcctcaggctcaggcgattctggat
ctgcgtttgcagaagctgactggtcttgagcatgagaaattgctggatgagtataaagaa
cttctgactcagattgccgggctgctgtacattctgcagaatccagaacgtctgatggaa
gtgatccgcgaagagctggaagcgatcaaagagcagtataacgatccccgtcgtacggaa
atcacccataacactgctgacatcaatattgaagatttgatcagccaggaagatgttgtg
gtgacgttgtctcatcagggctatgtcaaatatcagccgctgagcgactacgaagcacaa
cgtcgtggtggtaaaggcaaatctgctgcgcgtattaaagaagaagatttcatcgatcgc
ctgctggtggctaatacccatgacacaatcctgtgtttctccagtcgtggccgactctat
tggatgaaagtttaccagttgccggaagccagccgtggagcacgcggtcgcccgatcgtg
aatctgttgccgttggagccaaatgaacgtattacggctatcctaccggtacgtgagtac
gaagaagggaagagtgtgttcatggcaacggccagcggtacagtgaagaaaactgcactg
actggattcagccgtccacgcagcgccggtatcattgctgtgaatctgaatgacggtgat
gagctgatcggggttgatctcaccgatggtagcgatgaagtgatgttgttctctgctgcc
ggtaaagtggttcgcttctccgaaggcgcagtccgttgcatgggccggacagcgacaggc
gtgagaggtatcaacttgcagggcgaagatcgggtggtttccctgattattcctcgaggt
gagggcgatattctgacggtaacgcagaatggttttggcaagcgtactgcggtcatcgaa
tatccagtgaaatcccgtgctaccaagggtgtgatttcaatcaaggtgagcgatcgcaat
ggcaaggttgttggtgcggtgcaggttgatgcggctgatcagataatgatgattaccgat
gccggcacgctagtacgtacccgtgtatctgaagtcagcattgttggccgtaatacacaa
ggggttacgctgattcgcacagcagacgatgaaaatgtcgttggcttgcagcgggttgct
gaacctgtagaagacgaagaactggacggtgttgtggccgttgagggtgaagtgcctgaa
gacgagggtaatgtcgatgacatcgataacgatgacgacattcctgaagatgatgaataa

DBGET integrated database retrieval system