KEGG   Serratia sp. ATCC 39006: CWC46_19340
Entry
CWC46_19340       CDS       T05968                                 

Gene name
nirD
Definition
(GenBank) nitrite reductase (NAD(P)H) small subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
serq  Serratia sp. ATCC 39006
Pathway
serq00910  Nitrogen metabolism
serq01100  Metabolic pathways
serq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:serq00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CWC46_19340 (nirD)
Enzymes [BR:serq01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     CWC46_19340 (nirD)
SSDB
Motif
Pfam: Pyr_redox_2 Rieske_2 Pyr_redox Rubredoxin_C NIR_SIR Fer2_BFD Pyr_redox_3 NIR_SIR_ferr GIDA DAO AlaDh_PNT_C NAD_binding_8 K_oxygenase FAD_binding_2 HI0933_like FAD_binding_3 FAD_oxidored 3HCDH_N NAD_binding_7 ApbA Lycopene_cycl
Other DBs
NCBI-ProteinID: AUH02608
UniProt: A0A2I5TDG1
LinkDB
Position
complement(4251965..4256158)
AA seq 1397 aa
MKPHLVVIGNGMASARLVDTLLQLAPQHYQITVVGEEPRPGYNRILLSPVLSGEKTVAEI
LLPADGVSSAEDQSPAIRRYLGERVIAIDRQRRQVITTQRQIDYDHLVLATGSRPFMPSI
PGIDLRGVCGFRSLDDVELMLATISQCVPVVVIGGGLLGIEAAAALKRRGADVTLLHRRS
VLMERQLDATAGALLRDSLQSRSIVCETDVQVVALRGEFLNGADHVCAVVLADGRVIPAG
LVVVTAGVLPDSDLARQCGLTCHRGVLVDGQLRTSDPNISAIGECCELNGETFGLVAPCL
SQAMLLAARLAGHTPADYQREPVATRLKVTGIGVVSGGDINVAPDDELYTLFDPLEQHYR
RLLFRAGRLAGVLLYGDTNNNQHLLNIMENPQPETLRPSPTSLLFGLSFSDFDSQPAAVR
IPVMSKPVLVVIGHGMVGHYFLEQLVERDLHQRYHIVVFGEERHEAYDRVHLSEYFSGRS
AASLSLVKEGFFANSGIELRNAREIIHIDRQHQCVCDAQGRETAYDKLVMATGSYAFVPP
IPGNTRPGCLVYRTLDDLDAIAAQAKQSNVGVVIGGGLLGLEAANALRQLGLETHVVEFA
PRLMAVQLDDGGATMLRRKIEALGVRVHTGKETREIIDGEQAQHRLCFADGSVLETDLVL
FSAGIRPRDKLAEVCGLERGPRGGIVIDDACRTSDAAIFAIGECALWKGQIFGLVAPGYQ
MARSVADTLAERETPFTGADMSTKLKLLGVEVASVGDAHGRTPGSQSYQWMDGPNEVYKK
IILSADGKHLLGAVLVGDSGEYSTLLQMMLNDMPLPTQPESLILPARSGDAPKGLGVAAL
PASAQICSCHNVSKGDISAAVASGCTELGAIKSRTKAGTGCGGCVPLLKQVMEYELTQRG
VEVKKDICEHFAYSRQALYHLIRVHEIRSFDELVARYGHGLGCEICKPLVGSMLASCWND
YLLHPQHLPLQDTNDRFFANIQKDGTYSVVPRIPAGEITPQGLIAIGQVAQRYNLYTKIT
GGQRVDLFGARLEQLPAIWRELIDAGFETGHAYGKSLRTVKSCVGSTWCRYGVQDSTRLA
IALEQRYKGLRSPHKIKMAVSGCTRECSEAQGKDIGVIATDKGWNLYVCGNGGMKPRHAD
LFASDLDTETLIQTIDRVLMFYIRTADRLQRTSTWMDNLEGGIDYLRQVILDDSLNIGTE
LDNDMQRVVDSYQCEWQTTLESPARLALFRGFLNSDSPDEAVVMVPERGQIRPAQGDEKP
SANAPFALKPVDHETEWVHVGALQDIPANAGMAARIGQQQIALFHLSGSEPQVYALENHE
PGSGANVLSRGLIGDAAGQPVVISPLYKKRFRLCDGISPDDAELRVQVWPVRIEQGEIWV
NRQPLSLAKTAAMAEVS
NT seq 4194 nt   +upstreamnt  +downstreamnt
atgaaaccgcatctggtggtgattggtaatggcatggcaagcgccagactggtagacacg
ctgctgcaactggcaccgcagcactatcaaatcacagtcgtcggtgaggaaccacgcccc
ggctataaccgtattttattgtcaccggtgttgagcggtgaaaaaacggttgctgaaatc
ctgctgccagcggatggggtttccagcgctgaagatcaatcgcccgcgattcgtcgatat
ctgggggagcgagtgatcgctatcgatcgccaacggcgtcaggttatcactacgcaacgc
cagatcgactatgaccatctggtgctggccacaggttcccgaccttttatgccgtcgata
ccgggtatcgatctgcgaggcgtttgtggttttcgctctctggacgacgtggagttgatg
ctggcgacgatcagccagtgtgtacccgtggtggtgattggcggcgggctattggggatt
gaagcggcggcggcactgaagcgacgtggtgcggatgtcacgctgctgcaccgccgctcg
gtgttgatggaacgccaattggatgcgacggccggcgcgttgctgcgtgacagcttacag
tcacgcagcatcgtgtgtgaaaccgatgttcaggtggtggccttgcgtggtgagttcctc
aacggggcggatcacgtctgcgccgttgtactggcagatggccgggtgatacctgccggg
ctggtggtggtcacggcgggtgtcttgccggacagcgatctggcgcgccagtgtgggttg
acgtgtcatcgtggcgtgctggtggatggtcaactgcgtaccagcgatcctaacattagc
gccattggcgaatgctgtgaactgaacggcgaaaccttcggtctggtggccccctgtttg
tctcaggcgatgctgctggccgcacgtctggcaggccacacaccggcggattatcagcgc
gagccagtcgctacccgactgaaggtgaccggcatcggtgtggtcagcggcggcgacatc
aatgtggctcctgatgatgagctttacaccctgtttgatcctctggaacagcactatcgt
cgtttgctgtttcgcgctggccgtctggctggcgtcttgttgtacggcgatacgaataat
aaccagcacctgctgaacatcatggagaatcctcaacctgagaccttgcggccttctcct
acatcgctgctttttggtctttctttctctgattttgattcacagccagcggctgtaagg
attcctgtaatgagcaagccagttttggtggttatcggtcatggcatggtcggtcactat
tttcttgaacaactggtcgaacgcgatctgcatcagcgttatcacattgtggtttttggc
gaagagcgtcatgaagcctatgatcgtgttcacctttccgaatacttttccggtcgtagc
gctgcgtcgttgtcgctggtaaaagagggatttttcgccaacagtggtattgaactgcgc
aacgcccgtgaaatcatccatatcgatcgtcagcatcaatgtgtttgtgatgcgcagggc
cgagaaacagcttatgacaaactggtcatggcgaccggctcctatgcgtttgtaccgccg
atccccgggaatacgcgaccgggttgtctggtttatcgcacgctggatgatctggatgcc
atcgccgctcaggcgaagcagtccaacgtcggcgtggtgattggcggcggtctgttgggc
ctggaagcggcgaatgcgttacgtcagttggggctggaaacgcacgtggtggagtttgca
ccgcgtctgatggcggtacagcttgatgacggcggggcaacgatgctgcgccgcaaaatt
gaagcgttgggggtgcgggtacataccggcaaggaaacccgtgaaatcattgatggcgag
caggcgcaacatcggctgtgctttgccgacggtagtgtgctggaaactgatctggtgctg
ttttccgccggtattcgtccgcgcgataagctggctgaagtttgcggattggagagaggt
ccgcgtggcggcattgtgattgatgatgcctgccggacatcggatgcggcgattttcgcc
attggcgaatgcgcactctggaaaggacagatttttggcctggtggcgccgggttatcaa
atggcacgtagcgtggcagatacgctggcggagcgggaaaccccctttactggcgcggac
atgagcaccaaactgaagctgttaggcgtcgaggtggcgtcggtgggtgatgcgcatggc
cgcacgccgggcagtcaaagctatcagtggatggatgggccgaacgaggtttataaaaaa
atcatcctatccgcggacggtaaacatctgctgggcgcggtactggtgggtgacagtggt
gagtacagcacgttgttgcagatgatgttgaatgatatgccgctgcccactcagccggaa
agtttaattttgccagcccgctccggtgatgcgccaaaagggttgggtgtagcggcgtta
cctgccagcgcacagatatgttcctgccataacgtcagtaaaggcgatatttctgccgca
gtagccagcggctgcaccgaactgggggcgattaagtctcgcactaaagccggtacgggt
tgtggcggctgtgttccactgctgaaacaggtgatggagtatgaattgacgcaacggggt
gtcgaagtgaagaaagacatctgtgaacatttcgcctactcccgtcaggcgctttatcac
ctgatccgcgtccatgagatccgctcattcgacgaattagttgcgcgctatggtcacggt
ttgggctgtgaaatctgtaaaccgttggtgggttccatgctggcatcctgctggaatgat
tatttactgcacccccagcacctgccgttacaggataccaatgaccgcttcttcgccaat
atccagaaggatggcacctattctgtcgtgccgcgtataccggctggagaaattacccca
caagggctgattgctatcggtcaggtcgcgcagcgctacaacctgtataccaagattact
ggtggtcagcgtgtggatctgtttggcgcccggctggagcagttaccggcgatctggcgt
gaattgatcgacgccggttttgaaactggccatgcctacggcaaatcgttgcgcactgtg
aaatcctgtgttggatcaacctggtgtcgttacggcgtgcaggattccaccaggttggcc
attgcactggagcagcgttacaaagggctgcgttcaccgcataagataaaaatggccgtt
tccggctgtacccgtgaatgttcggaggcgcagggtaaagatatcggcgtgattgctacc
gataaggggtggaatctgtacgtgtgcggcaacggcggtatgaagccgcgccatgctgat
ctgtttgccagtgatctggataccgaaaccctgattcagaccatcgatagggtgttgatg
ttctacatccgtaccgctgatcggctacagcgcaccagcacctggatggataatctggaa
ggcggcatcgactacctgcgtcaggtcattctggatgatagcctcaacatcgggaccgaa
ctggacaacgacatgcagcgggtggtggacagctaccagtgcgagtggcaaaccacgctg
gagagtccggcgcgtctggcgctgttccgtgggttcctcaacagcgacagccccgacgaa
gcggtagtgatggtgccggaacggggacaaattcgtccggcgcagggtgatgaaaaaccg
tcagctaatgcgccatttgccttgaagccggtggatcatgagactgaatgggttcatgtc
ggcgcattgcaggatatccccgccaatgccgggatggcggcccgtatcgggcagcagcag
atcgctctgtttcatctctccggtagtgagccacaggtttacgcgctggaaaaccacgag
ccgggcagtggggcgaatgtgttgtcccgtgggctgattggcgacgcagccggccagccg
gtggtgatctccccgttatacaaaaaacgtttccgactgtgtgatggcatcagtccggat
gatgcggaactgcgtgtacaggtgtggccggtacggattgaacaaggggagatatgggtg
aaccgtcagccgctgagtctggctaaaactgcggccatggcggaagtatcatga

DBGET integrated database retrieval system