KEGG   Serratia sp. SCBI: SERRSCBI_01220Help
Entry
SERRSCBI_01220    CDS       T03314                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sers  Serratia sp. SCBI
Brite
KEGG Orthology (KO) [BR:sers00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sers03012]
    SERRSCBI_01220
   03029 Mitochondrial biogenesis [BR:sers03029]
    SERRSCBI_01220
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sers04147]
    SERRSCBI_01220
Translation factors [BR:sers03012]
 Eukaryotic Type
  Elongation factors
   SERRSCBI_01220
 Prokaryotic Type
   SERRSCBI_01220
Mitochondrial biogenesis [BR:sers03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SERRSCBI_01220
Exosome [BR:sers04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SERRSCBI_01220
  Exosomal proteins of breast cancer cells
   SERRSCBI_01220
  Exosomal proteins of colorectal cancer cells
   SERRSCBI_01220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Lsm_C cobW
Motif
Other DBs
NCBI-ProteinID: AIM19883
LinkDB All DBs
Position
280662..281846
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSAYDFPGDDLPVIRGSALKALE
GEAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVNMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccacggtaaaactaccctgactgcagcgatcactaccgtactggctaaaacctac
ggcggttctgcacgtgctttcgaccagatcgataacgcaccagaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgagtatgacaccccgactcgccactacgcgcacgtt
gactgcccagggcacgccgactacgtgaaaaacatgatcaccggtgctgctcagatggac
ggcgcgatcctggtagttgctgcgactgacggcccaatgcctcagacccgtgagcacatc
ctgctgggtcgtcaggttggcgttcctttcatcatcgtattcatgaacaaatgcgacatg
gttgatgatgaagagctgctggaactggtagaaatggaagttcgcgaactgctgtccgcg
tacgacttcccaggcgacgacctgccagtgatccgcggttccgcgctgaaagcgctggaa
ggcgaagctgagtgggaagcgaaaatcatcgaactggccgaagccctggacagctacatc
ccagagccagagcgtgctatcgacaagccgttcttgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgttgagcgcggtatcatcaaagttggc
gaagaagttgaaatcgttggtatcaaagacaccgttaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgccggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaaaccaggctctatcaag
ccgcacacccagttcgaatctgaagtgtacatcctgagcaaagatgaaggtggtcgtcac
acgccattcttcaaaggctaccgtccacagttctacttccgtactactgacgtgaccggt
accatcgaactgccagaaggcgtagagatggtaatgccaggcgacaacgtgaacatggtt
gtaaccctgattcacccaatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgctggtgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system