KEGG   Serratia sp. SCBI: SERRSCBI_06160Help
Entry
SERRSCBI_06160    CDS       T03314                                 

Definition
(GenBank) binding-protein-dependent transport system inner membrane protein
  KO
K02011  iron(III) transport system permease protein
Organism
sers  Serratia sp. SCBI
Pathway
sers02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sers00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SERRSCBI_06160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sers02000]
    SERRSCBI_06160
Transporters [BR:sers02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    SERRSCBI_06160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AIM20854
LinkDB All DBs
Position
complement(1360565..1362643)
Genome map
AA seq 692 aa AA seqDB search
MSHTHALHLVKKRDAISLWVLLGWLAFALLPSWSLDYGLLESTGEEILAAYGWSHRNISW
LWCLLPSLLLLRPYAAAGREQRRRHAFDAGWALLCMAFIVVSATVAGRGLGYATLVQLTA
LGAIMTLALTRLDWLGGDRFVIGALVTIVTLIGVFIVWPSIAIFIPMFTDQTGAFAPLAF
MNVLSQAHIIQVILNSIALSIAVGAGCTFFGLVLAIYTTRIARRSAIIGRIFSILPIVTP
PFVVGLGVTLMMGRSGYVTEWMVAWFGLTNTNWLYGFTGIWLAQVLAFTPMAFMILDGAI
KTIHPSLEEASYTLRASRWQTFNGVFVPLLKPALANAFLIVVVQSLADFSNPLVLGGNFD
VLATQIYFYITGSQLDYQAASTLGAFLLLFSLLVFCIQYMWIGKRSYVTVSGKSYRGDVQ
PLPVTLVWGVIALLAVWVAFNALLYGSIFYGSFTVNWGVDYTLTLDNFIKLFGQGMSDGA
WPSLLDTLLYAGIAAPITAAFGLLIAWIVVRQQFKGKKTIEFTTMLCFAVPGTVAGVSYI
LAFNGAPVYLTGTAAIVIISMVMRNVPVGIRAGIAGLGQIDKSLDEASLSLRAGSLRTIT
HILLPLLRPAILSALIYSFVRAITTVSAIVFLVTPDTRVATAYILNRVEDGEYGVAIAYG
SILIVVMLAIIFLFDWLIGEARISRSKAKNQA
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatacacatgcactccatctcgtgaaaaaacgagatgcgatatccctttgggtt
ttgcttggctggctggcgttcgccctgctgccgagctggagcctggattacggcctgctg
gagtccaccggcgaagagatcctcgcggcctacggctggtcacaccgcaatatcagctgg
ctttggtgcctgctgccgagcctgctgctgctgcgcccttacgctgcggcgggccgtgag
cagcggcgccgccacgcgttcgatgccggctgggcgctgctgtgcatggcctttatcgtt
gtcagcgccacggtggcgggacgcggtttaggctacgccaccctggtgcagttgaccgcg
ctgggcgccatcatgacgctggcgctgacccgcctcgactggctgggcggcgaccgtttc
gttatcggcgcgctggtcaccatcgtgacgctgatcggcgtcttcatcgtctggccgagc
atcgcgattttcattccgatgttcaccgaccagacgggcgcgttcgcgccgctggccttt
atgaacgtgctgtcgcaggcgcatatcattcaggtgatcctcaactccatcgccctgtcg
atcgcggtgggcgccggctgcacctttttcggcctggtgctggcgatttacactacccgc
atcgccaggcgcagcgccattatcggccgcatcttctccatcttgcccatcgtcacgccg
ccgttcgtcgtcggcctgggggtcacgctgatgatggggcgctccggctacgtcaccgag
tggatggtggcctggttcggtttgaccaacaccaactggctgtacggctttaccggcatc
tggctggcgcaggtgctggcgttcaccccgatggcgttcatgatcctcgacggcgcgatc
aagaccattcatccttcgctggaagaggcctcctacaccctgcgcgccagccgctggcaa
acctttaacggcgtgttcgtgccgctgctgaaaccggcgctggccaacgcgtttttgatc
gtggtggtgcaatcgctggctgatttcagcaacccgctggtgctcggcggcaacttcgac
gtgctggcgacgcaaatctatttttacatcaccggttcgcagctcgattatcaggccgcc
agcaccctcggcgccttcctgctgctgttctcactgctggtgttctgcattcagtatatg
tggatcggcaaacgttcctacgtcaccgtgtccggcaaatcatatcgcggcgacgtgcag
ccgctgccggtcacgctggtgtggggcgtgatcgcactgctggcggtgtgggtagccttt
aacgccctgctttacggcagcattttctacggcagcttcaccgtcaactggggagtggat
tacacgctgacgctggataacttcatcaaactgttcggccagggcatgagcgacggcgcg
tggccttcgctgctcgacacgctgctgtacgccgggatcgccgcgccgatcaccgccgcg
ttcggcctgctgatcgcctggatcgtggtgcgccagcagttcaagggcaaaaagaccatc
gagttcaccactatgctgtgctttgcggtgccgggtaccgtggccggcgtctcttacatt
ctcgcctttaacggcgcgccggtgtacctcaccgggacggccgccatcgtgattatttcg
atggtgatgcgcaacgtgccggtgggcattcgcgccgggatcgccgggctgggccagata
gacaaatcgctggacgaagcctcgctcagcctgcgcgccggctcgctgcgcaccatcacg
cacatcctgctgccgctgctgcgcccggcgatcctgtcggcgctgatctacagcttcgtg
cgcgccatcaccaccgtcagcgccatcgtcttcctggtcacccccgatacccgcgtggcc
accgcctacatcctcaatcgcgtggaagacggcgaatacggcgtggcgatcgcctacggt
tcaattctgatcgtggtgatgctggcgattattttcctctttgactggctgatcggcgag
gcacgcatctcccgttcaaaagccaaaaaccaggcgtaa

DBGET integrated database retrieval system