KEGG   Serratia sp. SCBI: SERRSCBI_12665Help
Entry
SERRSCBI_12665    CDS       T03314                                 

Definition
(GenBank) D-xylulose reductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
sers  Serratia sp. SCBI
Pathway
sers00040  Pentose and glucuronate interconversions
sers01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sers00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SERRSCBI_12665
Enzymes [BR:sers01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     SERRSCBI_12665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N DAO Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AIM22133
LinkDB All DBs
Position
2727015..2728049
Genome map
AA seq 344 aa AA seqDB search
MKALVLAKAGEIAIEDVQLAETLGPDDVQIKIHSVGICGSDVHYYQHGRIGPFVVKAPMV
LGHEAAGVVLATGENVTHLSVGDRVCMEPGIPDLNSAQTRAGIYNLDPAVRFWATPPVHG
CLRETVIHPAAFTFKLPDNVSFAEGAMVEPLAIGMQAATKAGIKPGDIALVIGAGPIGVV
TALAALAGGCSDVIICDLFDEKLAVAASYEGLHAVNIKTGDLAGKVAAFTSGNGVDIVFE
CSGAKPAIATLAEHAAPGATAVLVGMPIDAAPMDIVAAQAKEITFKTIFRYANMYPRTLR
LLSSGKLRVQPLISQTYKFSDSVAAFERAAAGHASDIKIMLEME
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattagtgctggccaaagcaggggaaatcgctatcgaggacgtccaactggcc
gaaacgctggggcccgacgatgtacagataaaaattcattccgtgggcatctgcggcagc
gatgtgcactattaccagcatggccgcattggcccgtttgtggtcaaagccccgatggtg
ctcggccatgaggccgccggcgtggtgctcgcgacaggtgaaaacgtcactcacctcagc
gttggcgatcgcgtttgcatggagcccggcattcccgacctcaactcggcgcagacgcgc
gccgggatttacaacctggaccccgccgttcgcttctgggcgacgccgccggtgcacggc
tgtttgcgcgaaaccgtcatccaccccgccgcattcacgttcaaactgccggacaacgtc
agtttcgctgaaggcgccatggttgaacccctggccatcggcatgcaagcggccaccaaa
gccgggatcaaacccggcgatatcgcgctggtgatcggcgctgggccgatcggcgtggtc
accgccctcgcggcgctggcgggtggctgctcggacgtcattatctgcgacctgtttgac
gagaaactcgccgtggcggccagctatgaagggctgcacgccgtcaatatcaaaaccggc
gacctggcgggtaaagtggctgcgttcaccagcggcaatggcgtcgatatcgtgtttgaa
tgcagcggcgcaaaaccggctatcgctacgctggccgaacatgcggcgccaggggcgacc
gccgtgctggtcggcatgccgatcgacgccgcgccgatggatatcgtcgcagcacaggcc
aaggaaatcaccttcaagaccattttccgctacgccaacatgtatccgcgcacgctgcgg
ctgttgagcagcggcaaattgcgcgtccaaccgttgataagccaaacctacaaattctcc
gacagcgtggcggccttcgagcgcgcggcggcgggacatgcctcggacatcaaaatcatg
ctggaaatggagtga

DBGET integrated database retrieval system