KEGG   Serratia sp. SCBI: SERRSCBI_17475Help
Entry
SERRSCBI_17475    CDS       T03314                                 

Definition
(GenBank) Zinc-binding dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
sers  Serratia sp. SCBI
Brite
KEGG Orthology (KO) [BR:sers00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SERRSCBI_17475
Enzymes [BR:sers01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SERRSCBI_17475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AIM23071
LinkDB All DBs
Position
complement(3721010..3722122)
Genome map
AA seq 370 aa AA seqDB search
MCQTCMTEAKMADGIPEIMKAVVAYAPKDYRLEQVPVPKIGPKEILVKIEACGICAGDVK
AFEGAPSFWGDEKQPAYIKAPMIPGHEFIGHVVGYGEGVEGFNLGDRVISEQIVPCWQCR
FCNRGQYWMCEKHDLYGFQKNVNGGMAEYMKFTKEAINYHVPADLPIEKAILIEPYACSF
HAVQRANIKLGDVVVLAGAGTLGLGMIGAIKKSGPSKLVVLDLSDERLALAKRFGADVTL
NPTRDDVPAAVKAMTDGYGCDIYIEATGAQKSVEQGLTLIRKLGTFVEFSVFKDPVTVDW
SIISDRKELDVLGSHLGPYCYPLVIEGIANGDLPTEGVVTHTLPLEQFAEGFELMKRGIG
SIKVVLNPNL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcagacctgcatgacagaggcgaaaatggcggacggtatccccgagatcatgaag
gcggttgtggcgtacgccccgaaagattaccgcctggaacaggtgccggtgccgaagatc
ggcccgaaagagatcctggtgaagatcgaggcctgcggcatctgcgccggcgatgttaaa
gcgttcgaaggggcgcccagcttctggggcgatgaaaaacaaccggcatacatcaaggcg
ccgatgatccccggtcatgagtttatcggccacgtggtgggatacggcgaaggcgtcgag
ggcttcaatctcggcgatcgggtgatatcagaacagatcgttccctgttggcaatgccgc
ttctgcaaccgcggccagtattggatgtgcgaaaagcatgacctgtacggtttccagaaa
aacgtcaatggcggcatggccgagtacatgaagttcaccaaagaggcgattaactatcac
gtaccggccgatctgccgatcgaaaaagccattctgatcgaaccctatgcttgctccttc
catgcggtgcaacgcgccaatatcaaactgggcgatgtcgtggtgctggccggcgccggc
accctggggctgggcatgatcggggcgatcaaaaagtccgggccctcgaagctggtggtg
ctggatctgtccgacgagcgtctggcgctggcgaagcgcttcggcgcggatgtgacgctg
aacccgacccgtgacgacgtgcccgcggcggttaaagcgatgaccgacggctacggctgc
gacatctacatcgaggcgaccggcgcccaaaagtccgtggaacagggcctgacgctgatc
cgcaagctcggcaccttcgtggaattttccgtgttcaaggatccggtgaccgtcgactgg
agcatcatcagcgaccgcaaggagctggacgtgctcggttcgcacctcggcccttactgc
tacccgctggtgatcgaaggcatcgccaatggcgatctgccgaccgaaggcgtggtgacg
catacgctgccgctggaacagttcgccgagggcttcgagctgatgaagcgcggcatcggt
tcaatcaaagtggtgcttaatccaaacctctga

DBGET integrated database retrieval system