KEGG   Serratia sp. SCBI: SERRSCBI_17730Help
Entry
SERRSCBI_17730    CDS       T03314                                 

Definition
(GenBank) phosphate transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sers  Serratia sp. SCBI
Pathway
sers02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sers00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SERRSCBI_17730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sers02000]
    SERRSCBI_17730
Enzymes [BR:sers01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     SERRSCBI_17730
Transporters [BR:sers02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    SERRSCBI_17730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_22 AAA_16 SMC_N RsgA_GTPase AAA_23 AAA_29 Rad17 AAA_30 AAA_25 AAA_5 TniB AAA_15 AAA_33 NB-ARC AAA_28 NACHT
Motif
Other DBs
NCBI-ProteinID: AIM23122
LinkDB All DBs
Position
complement(3775869..3776681)
Genome map
AA seq 270 aa AA seqDB search
MGLMTPGSLPRLDVQHLDDEQTALAVNGLNLFYGDKQVLHDISLRIPKHRVTALIGPSGC
GKSTLLRCFNRMNDLVDNCRIEGELQLNGAAISGAQIDVAALRRRVGMVFQRPNPFPKSI
YENVVYGLRLQGVRDRRLLDEAVERSLRAAALWHEVKDRLRENAFRLSSGQQQRLVIARA
IAIEPEVLLLDEPTSALDPISTLTIEELISALKQRYSVVLVTHNMQQAARVSDYTAFIHQ
GRLVEYNDTDAIFTSPRQRRTEDYITGRYG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgatgacgccaggcagtttgccccggctggatgtccagcatctcgacgatgaa
cagaccgcgctggcggtcaacggcctgaacctgttttatggtgacaagcaggtgctgcac
gatatctcgctgcgtatcccgaaacaccgggtgacggccctgatcggcccttcgggctgc
ggcaaatcgacgctgctgcgctgtttcaaccgcatgaacgatctggtggacaactgccgc
atcgagggcgaactgcagctgaacggcgcggcgatctccggcgcgcagatcgacgtggcg
gcgctgcggcggcgggtgggcatggtgttccagcggccgaacccgttcccgaaatcgatc
tatgaaaacgtggtgtacggcctgcggctgcagggcgtgcgcgaccggcgtttgctggat
gaagcggtggagcgttcgctgcgcgccgccgcgctgtggcatgaggtgaaggaccggctg
cgcgaaaacgccttccgcttgtccagcggccagcagcagcgcctggtgatcgcgcgcgcc
atcgccatcgagccggaagtgctgttgctcgacgagccgacctcggcgctggatccgatc
tccacgctgaccatcgaagagctgatttcggcgctgaagcagcgctatagcgtggtgctg
gtgacgcacaacatgcagcaagcggcgcgcgtctccgactacaccgcctttattcatcag
gggcggctggtggaatacaacgacaccgacgccattttcacgtcgccgcgccagcgccgc
accgaggattatattaccgggcggtatgggtga

DBGET integrated database retrieval system